KEGG   Erwinia amylovora ATCC 49946: EAM_1194Help
Entry
EAM_1194          CDS       T01199                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (phosphoglyceromutase)
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00010  Glycolysis / Gluconeogenesis
eay00260  Glycine, serine and threonine metabolism
eay00680  Methane metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
eay01230  Biosynthesis of amino acids
Module
eay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eay_M00002  Glycolysis, core module involving three-carbon compounds
eay_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_1194 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EAM_1194 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAM_1194 (gpmA)
Enzymes [BR:eay01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAM_1194 (gpmA)
Membrane trafficking [BR:eay04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EAM_1194 (gpmA)
Exosome [BR:eay04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAM_1194 (gpmA)
  Exosomal proteins of melanoma cells
   EAM_1194 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ45869
Position
complement(1302251..1303003)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLTTEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggattcaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtcgagaaatcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggtcaagcagtggcgtcgtggcttcgcc
gttaccccgcctgagcttgatcgtgccgacgagcgcttcccgggccacgacccgcgttat
gcttcattgaccacagaacagttaccgacgaccgaaagtctggcgctgactattgaccgc
gtgctgccatactggaatgaatccatcctgccgcgtatgaaaagcggtgagaaagtgatc
attgctgcgcacggtaactccctgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaacatcccaaccggcgtaccgctggtttatgagttcgacgaa
aactttaagccgatcaaacattactatcttggtgatgctgatgaaatcgccgctaaggca
gctgccgtagctaatcagggtaaagcaaagtaa

DBGET integrated database retrieval system