KEGG   Erwinia amylovora ATCC 49946: EAM_1471Help
Entry
EAM_1471          CDS       T01199                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eay00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:eay00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592816..1593847
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVLGCELDAEEREILQHPLTGGLILFSRNYHDPVQLRELVRQIRSASRHRLLVA
VDQEGGRVQRFRQGFSRLPAMQAFAALNPSPEAEKLAQQAGWLMASEMIAMDIDISFAPV
LDIGHGSAAIGERSFHQDPAVALQMARCFIRGMRDAGMKTTGKHFPGHGAVSADSHKETP
RDTRSEAEIRQQDMPIFQQLIAEQALDAIMPAHVIYTQVDPRPASGSPHWLKSVLRQELG
YDGVIFSDDLSMEGAAIMGSYPERARSALEAGCDMILVCNNRPGAVSVLDNLPAMASARA
ARLFHRGKVTRQQLIDSPRWKETSAALARLQDRWLAHKADAGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggaccggtaatgttagacgtgctcggttgcgagctggatgcggaagagcgtgaaatt
ttacagcatccgctgacgggtggactgatcctgttcagccgcaactatcacgatccggtg
cagctgcgcgagctggtgcgccagatccgcagcgcatcgcgtcatcgtctgctggtggcg
gtggatcaggaaggcggccgcgtgcagcgctttcgtcagggattttcccggctgcctgca
atgcaggcgtttgcggcgcttaacccgtcgcctgaggctgaaaaactggcacagcaggcc
ggctggctgatggcgtcagagatgatcgccatggatattgatatcagctttgctccggta
ctggacattggtcacggcagcgcggctatcggcgagcgctccttccatcaagatccggcc
gtagcgttgcaaatggcccgctgctttattcgcggaatgcgtgacgccggcatgaaaacg
accggcaagcatttccccgggcatggtgccgtcagtgccgattcgcacaaagagacgccg
cgtgacacgcgcagcgaagcggagatccgccagcaagatatgccgatttttcagcagctg
atagcggaacaggcgctggatgccattatgcccgcccacgttatctatacgcaggtggac
ccgcgtcctgccagcggctccccgcactggttaaaaagcgtgctgcgtcaggagctgggc
tatgatggcgtgattttctccgacgatctgtcaatggaaggcgcagcgattatgggcagc
taccccgaacgcgcccggtccgcgctggaagccggatgcgatatgatcctggtgtgcaac
aacaggcctggcgcggtaagcgtgctggataacctgccagcgatggcgtctgcaagggct
gcccggctgttccaccgggggaaagttacccgccagcagcttatcgactcaccgcgctgg
aaggaaaccagcgccgcgctggcccggctacaggatcgctggctggcccataaagcggat
gcgggcagctaa

DBGET integrated database retrieval system