KEGG   Erwinia amylovora ATCC 49946: EAM_1880Help
Entry
EAM_1880          CDS       T01199                                 

Gene name
trpC
Definition
(GenBank) anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01130  Biosynthesis of antibiotics
eay01230  Biosynthesis of amino acids
Module
eay_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAM_1880 (trpC)
Enzymes [BR:eay01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EAM_1880 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     EAM_1880 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI BtpA
Motif
Other DBs
NCBI-ProteinID: CBJ46555
Position
2022342..2023703
Genome map
AA seq 453 aa AA seqDB search
MQQTVLDRIVRDKTDWLAARQQQQPLASFQHEIVPATRNFYEGLKGARTAFILECKKASP
SKGLIREDFDPAVIAGVYRHYASAISVLTDEKYFQGSFDFLPIVSAAVSQPVLCKDFIID
PYQIHLARYYQADAILLMLSVLNDEQYRQLAAVAHSLNMGVLTEAISDEELERATALGAK
VVGINNRDLRDLSIDLDRTRRLAPKVAQGVTVISESGINSYAQVRELSHFADGFLIGSAL
MSEDNLAAAVRRVIIGENKVCGLTRPQDARSALECGAIYGGLIFAAGSPRQIDAARAQEV
MAAAALRYVGVFRNDGLSDVVTIARRLNLHAVQLHGDEDREFISQLRAALPENVQIWKAF
SISTSLPARDWPHVDRYVFDQGNGGSGKAFDWSLLQGEKWDNVLLAGGLSADNCLLAAQQ
GCAGLDFNSGVESAPGIKDAAKMASVFHTLKAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaccgtacttgatcgcatcgtgcgcgataaaaccgactggctggcggctcgc
cagcagcagcagcctctggcctcgtttcagcatgagattgtcccggctacgcgcaacttc
tacgaggggctgaagggcgcccgtaccgcgttcattctggagtgcaaaaaagcctcgccg
tccaaaggattgatccgtgaagactttgacccggcggtgattgccggcgtctaccggcat
tacgcctccgccatctcggtgctgaccgatgagaagtactttcagggaagctttgacttt
ctccccatcgtcagtgcagcagtcagtcaaccggtactgtgtaaagactttatcatcgac
ccgtatcagatccatctggcgcgctattatcaggccgacgccattctgctgatgctgtcg
gtactgaatgacgagcagtaccgccagctggccgccgtggcacacagcctgaatatgggc
gtgctgacggaagcgatcagcgatgaagagcttgagcgcgccaccgcgctgggcgcaaaa
gtggtcggcatcaataaccgtgatttacgcgatctgtcaatcgacctcgaccgtacccgc
cgtctggcgccgaaagtggcacagggcgtgacggtcatcagtgaatcaggcatcaacagc
tatgcccaggtgcgcgaactgagtcacttcgccgacggcttcctgataggttcggcgctg
atgtcggaagacaaccttgccgctgcggtcaggcgggtgattatcggtgagaacaaagtc
tgcggactgacccgcccgcaagatgcgcgcagcgcgctggagtgcggggctatctatggc
gggctgatctttgccgccggatcgccgcgccagattgacgccgcacgggcgcaagaggtc
atggccgccgccgcactcaggtacgttggcgtgttccgtaatgacggcctgagtgacgtt
gtcactatcgcgcggcggctcaacctgcacgcggtacagctgcacggtgatgaagatcgc
gagttcattagccagctacgagccgcattgcctgaaaacgtgcagatctggaaagccttc
agcatcagcaccagcctgcccgctcgcgactggccgcacgtcgatcgctacgtatttgac
cagggaaatggcggcagcggtaaagcgtttgactggtcgctgttacaaggtgaaaagtgg
gataacgtcctgctggccggcggcctgagtgcggacaactgccttctggccgcacagcag
ggctgtgccggtctcgactttaattccggcgtggagagcgctcccggaatcaaagatgca
gcaaaaatggcttccgtgttccatacgttgaaagcctactga

DBGET integrated database retrieval system