KEGG   Erwinia amylovora ATCC 49946: EAM_1882Help
Entry
EAM_1882          CDS       T01199                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAM_1882 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAM_1882 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAM_1882 (trpA)
Enzymes [BR:eay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAM_1882 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2024908..2025714
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPELSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQSANLRAFAAGVTPEQCFELLAVIRQKYPQLPIGLLMYANLVFSNGIDNFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNAGDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLRHLVDKLREYHAAPALQGFGISEASQVQQAIAAGAAGAISGSAVVKI
IEKHLADPALMLSELTAFAARLKDATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttacgacctctgttttaaacgtctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccgaactgtcgttacagattatcgatgcgctg
gtggcgggcggtgccgatgcccttgagctgggtattcccttttctgacccgctggcagat
ggccccaccatccagagtgcgaatctgcgcgcctttgctgccggggtaacgccagagcag
tgttttgaactgctggcggttattcggcaaaaatacccacagctgcccattggcctgcta
atgtacgccaacctggtcttctccaacggcattgataacttctatgcccgttgccagcag
gttggcgttgattcggtgctggtagccgacgtgccggttgaggagtctgcgccgttccgc
caggcggccatgcgccataacgttgcaccgatttttatctgcccgccaaacgccggtgac
gatttactgcgcgaaatcgcctctcacggccggggttatacttacctgctgtcgcgcgcc
ggggtgaccggttcagaaacccgtgccagtcttccgctcagacatctggtggataaactg
cgcgagtatcatgctgcccccgcgctgcagggctttggtatttcagaagcctcacaggtg
cagcaggcgattgcggccggggcggccggggctatctcaggttctgccgtggtcaaaatc
attgaaaaacatctggccgatcctgcgctgatgctgtctgaactgaccgcctttgccgcc
cgtctgaaagacgctacccgaagctga

DBGET integrated database retrieval system