KEGG   Erwinia amylovora ATCC 49946: EAM_1918Help
Entry
EAM_1918          CDS       T01199                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00040  Pentose and glucuronate interconversions
eay00052  Galactose metabolism
eay00500  Starch and sucrose metabolism
eay00520  Amino sugar and nucleotide sugar metabolism
eay01100  Metabolic pathways
eay01130  Biosynthesis of antibiotics
Module
eay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAM_1918 (galU)
   00052 Galactose metabolism
    EAM_1918 (galU)
   00500 Starch and sucrose metabolism
    EAM_1918 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EAM_1918 (galU)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAM_1918 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBJ46593
Structure
PDB: 

Jmol
Position
complement(2061909..2062817)
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCQGAQLNPGDSAPMVGVVEKPKADQAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgctggtttgggaacg
cgtatgttgcctgctaccaaagcgattccgaaagagatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgctgggatcaatgagatcgtgctggtt
acgcactcatccaagaactcaattgaaaaccatttcgataccagcttcgagctggaagct
atgctggaaaagcgtgtaaaacgccagctgctggaagaaattcagtcaatttgtccgcca
cacgttaccatcatgcaggtgcgtcaggggctggctaaaggcctgggccacgcagtaatg
tgcgcatggccggtgattggtaacgagccggtagccgttatcctgccggatgtgattctg
gatgaatacgaatcagatttgtcgaaagacaacctggcagaaatgatcagacgcttcgat
gaaactggccacagccagatcatggttgaacccgttgctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcagctgaacccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacccaaagccgatcaggccccttcaaatctggcagttgtcgggcgttacgtgctg
tctgcagatatctggccactgctggctaaaacgcctccgggcgccggtgatgaaatccag
ctgaccgactcaattgccatgctgatggagaaagagacggtagaagcttatcacctgaaa
ggtgtgagccatgactgtggtaacaagctcggctacatgcaggctttcgttgaatatggt
gtgcgtcacgaaacactgggcagcgatttcaaagcctggctggaaagcgctgtcggcaac
aaaaagtaa

DBGET integrated database retrieval system