KEGG   Erwinia amylovora ATCC 49946: EAM_1928Help
Entry
EAM_1928          CDS       T01199                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:eay00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2074170..2074784
Genome map
AA seq 204 aa AA seqDB search
MRIRQALLLIDLQNDFCSGGALAVSEGEQTIAVANRLAAEFQQRGEAVIATLDWHPADHG
SFASNAGTIAGTLGDLNGLPQIWWPDHCVQHSQGAQLHPLLDRAAISLLVHKGENAEIDS
YSAFYDNGHRQQTRLHGWLHEHGITALTVMGLATDYCVKFSVMDALDLGYRVTVVRAGCR
GVNLHPDDSENALMTMAQAGAIII
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagaatacgtcaggcattgttgttaatagacctgcaaaatgacttttgttccggcggg
gctttggccgtcagcgaaggggaacagaccatcgccgtcgctaatcgccttgctgccgaa
tttcagcaacgcggcgaggcagtcatcgccaccctcgactggcatcctgcagatcatggc
agttttgcctctaacgccgggacaatagcgggaaccctgggcgatttgaacgggttacca
caaatctggtggccggatcattgcgtgcagcatagccagggtgcgcagctgcatcctctg
ctcgatcgcgcagcaatcagcctgctggtgcacaaaggtgagaatgcagaaattgatagc
tacagtgcattttatgataatggccatcgccagcagacgcggttacacggctggctgcat
gagcatggcattacggccctgactgtgatgggcctggcgaccgattactgcgtgaagttt
agcgtgatggatgcactggatctgggctaccgggtgacggtggtgagagcgggctgccgt
ggcgtcaatctccatcctgatgacagtgaaaacgccctgatgacgatggcacaggcaggt
gccatcatcatttaa

DBGET integrated database retrieval system