KEGG   Erwinia amylovora ATCC 49946: EAM_2162Help
Entry
EAM_2162          CDS       T01199                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAM_2162 (galF)
   00052 Galactose metabolism
    EAM_2162 (galF)
   00500 Starch and sucrose metabolism
    EAM_2162 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EAM_2162 (galF)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAM_2162 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2316880..2317776)
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTSYELEALLEARVKRSLLSEVKSICPPGVTIMNVRQPQPLGLANALLCARPM
LHDEAFVVVLPDVLLDNASADPLRYNLAAMVARFEETGRSQVLAHHMPDADLSEYSVITT
EEPLDFPGKVSSILEFVEKPENPEALNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLT
DAIVSLNKKTPVDAQLLSGDSFDCGRKLGYMKAFVTWGLRNHSQGRAFRDEIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagttatcccggttgcaggtctcggaatgcatatgcttcctgca
acaaaagctattcctaaagagatgctgcccgtcgtcgataagcctatgatccaatacatt
atcgatgagtgcgtggcagcgggtattaaggaaattgttctggtcacccatgcatccaag
aatgcggttgaaaaccattttgatacctcctacgaactggaagccttgcttgaagcccgc
gttaaacgctccttgctcagcgaggtaaaatctatctgcccaccaggtgtgacgatcatg
aacgtgcgccagccacagccgctggggctggctaatgctctgttatgcgcccgtccaatg
ctgcatgatgaagcgtttgtggtggtgctgcctgacgtgctgctggataatgccagcgcc
gatccgttgcgttacaacctggcggcgatggtagcgcgttttgaagaaaccgggcgtagc
caggtgctggctcaccacatgccggacgccgatctttcagagtattcagtgattaccacc
gaggagccgttggacttcccaggtaaagtgagctccattctggaattcgtagaaaaacca
gaaaacccggaagcgctgaattccgatctcgccgcagtagggcgttatgtgttgtctgcc
gatatctggcccgagctggaagcgctggagccgggtgcatggggtcgctaccagctaact
gatgccatcgtcagtttgaataagaaaacgcctgttgatgcgcaactgctcagtggcgat
agctttgactgcgggcgcaaacttggttatatgaaagcttttgttacctggggcttgcgt
aatcacagtcaggggcgtgcgttccgcgatgagatccagaaaattttggccaaataa

DBGET integrated database retrieval system