KEGG   Erwinia amylovora ATCC 49946: EAM_2346Help
Entry
EAM_2346          CDS       T01199                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha [includes: enoyl-CoA hydratase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase]
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00071  Fatty acid degradation
eay00280  Valine, leucine and isoleucine degradation
eay00281  Geraniol degradation
eay00310  Lysine degradation
eay00362  Benzoate degradation
eay00380  Tryptophan metabolism
eay00410  beta-Alanine metabolism
eay00640  Propanoate metabolism
eay00650  Butanoate metabolism
eay00903  Limonene and pinene degradation
eay00930  Caprolactam degradation
eay01040  Biosynthesis of unsaturated fatty acids
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
eay01212  Fatty acid metabolism
Module
eay_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EAM_2346 (fadJ)
   00650 Butanoate metabolism
    EAM_2346 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EAM_2346 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EAM_2346 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAM_2346 (fadJ)
   00310 Lysine degradation
    EAM_2346 (fadJ)
   00380 Tryptophan metabolism
    EAM_2346 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAM_2346 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EAM_2346 (fadJ)
   00281 Geraniol degradation
    EAM_2346 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAM_2346 (fadJ)
   00930 Caprolactam degradation
    EAM_2346 (fadJ)
Enzymes [BR:eay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EAM_2346 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EAM_2346 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EAM_2346 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF2188
Motif
Other DBs
NCBI-ProteinID: CBJ47020
Position
complement(2542634..2544781)
Genome map
AA seq 715 aa AA seqDB search
MDLPSALSLTLRPDRVGVITIDVPHEKVNTLKVEFAADILALVRQARANPHLAGLVLISA
KPDSFIVGADISTIAACHHAQQATALAQAGQKAMAEIAALPFPVVAAIHGACLGGGLELA
LACHRRVCSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLTGIRVALEMMLTGKTLDARSAL
RCGLVDETVDHAILLDAAVQLALKPLTTAPRPSLSERLLTSAPGRAVLFTLAQRRTRSQT
HGNYPAAEKILSVVRCGLTPGGSGYSAEAQAFGELVMTPQSAALRSLFFATTGLKKAHFG
VEPHELKRIGVLGGGLMGGGIACITATRAGLPVRIKDINANGINHALKTSWQTLTSAVDR
RRLSAAQRQQQMAFITGGTDYQGFRQCDMVIEAVFEDLALKQKMVAEIEANCSAHTLFAS
NTSSLPIADIAAAAQRPENVIGLHYFSPPEKMPLVEVIPHAGTSAQAIATAVMLARKQGK
TPIVVADRAGFYVNRILAPYIIEALHCLREGEPVEYIDRALVQFGFPLGPLQLLDEVGLD
VGTHIMPILQHAWGERFSLPAGLEALWQDGRKGRKNGRGFYLYPQKGGKKRVDSTLYRLL
PVRVKHHLGAEPVSRRCVMMLLNEAARTLGEQGIASARDGDIGAVMGIGFPPFFGGPFRY
MDQLGSVEVVNCLTQLMQQHGPRFTPCSLLQKMAAEGKTFYQSDVKSDKPADSAG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccatctgcattgagccttaccttgcgcccggatcgggtcggcgttatcacc
atcgatgtgccgcatgaaaaggtcaacacgctgaaagtcgaatttgccgccgatattctg
gcgcttgtccggcaggcgcgggcgaacccgcatctggccgggctggtactgatttcggct
aagcctgacagctttattgttggggcggatatcagcacgatcgccgcttgccaccatgca
cagcaggcgaccgcattggctcaggccgggcaaaaggcgatggcggagatagccgcactg
ccgttcccggtcgttgcggctatccacggtgcctgcctcggcggcggccttgaactggcg
ctggcttgccatcgccgcgtctgttcgctggatgataaaacccggcttggcttaccggaa
gtgcagctcggcctgctgccgggttccggcgggacgcagcgtctgccgcgcctgactggc
atccgcgtggcgttagagatgatgttgacgggtaaaacgctggatgcccgtagcgcatta
cgctgcgggctggtggacgagacggtcgatcacgccattctgctggacgcggcagtgcag
ctggcgctaaagccgctcactaccgcgccgcgtccctctctgagcgaacggctgttgacc
agcgcgcccggccgcgcggtgctgtttacgctggcacagcgccggacgcggtcgcaaacc
cacggcaactatccggcggcggaaaaaattctcagcgtggtgcgctgcgggctgacgccg
ggcggcagcggctattcagctgaagcacaggcgtttggtgaactggtgatgaccccgcag
tctgccgcgctgcgcagcctgtttttcgccaccactgggttaaaaaaagcgcactttggt
gttgaaccccatgaactgaaacgcattggcgtactgggcggtggcctgatgggcggcggt
attgcctgcataaccgctactcgtgccgggttgccggtgcgcatcaaagacatcaatgcc
aacggcattaaccatgcgctgaaaaccagctggcagacgctgaccagcgcggtggatcgc
cgccgcctgagcgcggcacagcgccagcagcagatggcctttatcaccggcggcaccgat
tatcagggcttccgccagtgcgatatggtaatcgaagcggtattcgaagacctggcgctg
aagcaaaaaatggtggcggaaattgaagcgaactgcagcgcccatacgctgtttgcctct
aacacctcttctttgcccatagccgacattgccgccgccgcgcagcggcctgagaacgtc
atcggcctgcattatttcagcccaccggagaaaatgccgctggttgaagtgatccctcat
gccggcacctctgcccaggccatcgccaccgcggtgatgctggcacgaaaacagggcaag
acgccaatcgtggtggccgaccgggcgggcttctacgtcaaccgcattctggcaccctat
atcatcgaagcgctgcactgtctgcgcgaaggcgaaccggttgaatatatcgaccgggcg
ctggtgcagtttggttttccccttggcccgttacagctgctggatgaggtcgggctggat
gtcggtacgcatattatgccgatcctgcaacacgcatggggcgaacgcttctcgctgccg
gcggggctggaagcgctatggcaggatgggcgtaaaggccgcaaaaacgggcgtgggttc
tatctgtacccgcaaaaaggcggtaaaaagcgcgtcgacagcacgctgtaccgcctgctg
ccggtcagggtgaaacatcatcttggcgcagagcctgtttcccgccgctgtgtgatgatg
ctgctgaacgaggcggcacgcacgctgggtgagcaggggatcgccagcgcgcgcgatggc
gatatcggcgcggtaatgggtatcggttttccccctttcttcggcgggccgttccgctat
atggaccagctgggcagcgttgaagtggttaattgtttaacgcagctaatgcaacagcac
gggccacgttttaccccttgctccctgctgcaaaaaatggcggctgaaggcaaaaccttt
taccaaagcgacgttaaatctgacaaacctgctgattcagctggttag

DBGET integrated database retrieval system