KEGG   Erwinia amylovora ATCC 49946: EAM_2933Help
Entry
EAM_2933          CDS       T01199                                 

Gene name
bglY
Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_2933 (bglY)
Enzymes [BR:eay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EAM_2933 (bglY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3195521..3196948
Genome map
AA seq 475 aa AA seqDB search
MQYPGLTPFPDDFLWGASTSAYQVEGAADRDGKGPSVIDKAQFDPRLSDFSVTSDHYHRF
AEDVALFAELGLKTYRFSISWSRLFPQGIGERNAQGVDFYQRLIDALTEHGIEPLVTLYH
FDLPWALQEKGGWSDPATIDAFEHFARTCFGLYGDRVKYWLTINEQNMMILKGDIIGTLP
AGTPNPHKTLYQQNHHMMLAQARVMIACHQMLPAAKIGPAPNISCVYPATSKPQDVLAAN
NFTAIRNWLYLDLACHGRYNTVAWRFLEEKGWLPDIRATDMSLLKQAKPDFIAFNYYASA
TVAAETSEQKAAEHRVDQQMAGTDRCVYVGTNNPHLPKTPFNWYVDPVGFRITAREIYDR
YRLPLLVTENGLGACDRLAEGNKIYDDYRIEYLSEHLAQLQLAISDGVRIFGYCPWSAID
LVSTHQGISKRYGFIYVNRDEQDLKDLARYRKKSFHWYQRVISSNGAQLSQQVDY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccctggtttaacacccttccctgacgattttttatggggagcatccacttcg
gcctatcaggttgagggcgcggcagatcgggatggcaaagggccatcggtgatcgataag
gcacagtttgacccgcgcctcagtgacttcagcgttaccagcgatcactaccaccgcttt
gccgaggatgtggcattgttcgctgaactggggctgaaaacctaccgtttttccatttcg
tggagccgcctgtttcctcagggcattggcgagcggaatgcgcaaggcgtggacttctac
cagcggctgatcgatgccctgactgaacatggcattgagccactggtcacgctgtaccat
ttcgatcttccctgggcgctacaggaaaaaggcggttggtctgacccggccaccatcgac
gcatttgagcattttgcccgcacctgcttcgggctttacggcgatcgggtgaaatactgg
ctgaccattaatgagcagaacatgatgatcctcaaaggggatattatcggtacactgccc
gccggaacgccaaacccgcataaaacgctgtatcagcaaaaccatcatatgatgctggca
caggcgcgggtgatgattgcctgccaccagatgctgccggcggctaagattggcccggca
ccgaatatctcctgcgtgtacccggccaccagtaaaccgcaagacgtgctggcagcgaat
aatttcaccgcgatccgtaactggctgtatctcgatctcgcctgccatggccgatacaac
acggtcgcctggcgcttcctggaggaaaagggctggctgcctgacattcgcgcaactgat
atgagcctgctgaagcaggcgaagcctgactttattgcctttaattactatgcctccgcc
accgttgccgcggaaacaagcgagcaaaaggcagcagaacacagagtcgatcagcaaatg
gccggtaccgaccgctgcgtgtatgtcggcaccaataacccgcatctgccgaagaccccg
tttaactggtacgtcgatccagtcggttttcgtattaccgcccgcgaaatctacgatcgc
taccggctgccgctgctggtcacggaaaacggccttggagcctgtgatcggctggcggag
ggtaacaagatttacgacgattaccgtattgagtatctcagcgagcatctggcacagctg
cagcttgccatcagcgatggtgtgcggatcttcggttactgcccgtggtcagcgatcgat
ctggtcagtactcatcaggggatcagcaagcgttacggctttatctatgtcaaccgcgac
gaacaggatctgaaagatctggcgcgctatcgtaagaagagttttcactggtatcagcgc
gttatcagcagcaacggcgcgcaactgagccagcaggttgattattaa

DBGET integrated database retrieval system