KEGG   Erwinia amylovora ATCC 49946: EAM_2934Help
Entry
EAM_2934          CDS       T01199                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eay00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3197016..3198449
Genome map
AA seq 477 aa AA seqDB search
MSLPNDFLWGGAVAAHQVEGGWDQGGKGPSIVDVLSGGAHGVDRVITDGVDAAHHYPNHQ
AVDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPQGDELEPNEAGLQFYDDLFDELLKYN
IEPVITLSHFEMPQHLVKEYGGWLNRNVVDFFVRYSEVVLKRYQHKVKYWMTFNEINNQR
NWRYPLFGYCNSGVIFTDHEKPEQAMYQVLHHQFVASARVVKLGHQINPDLKIGCMLAIV
PLYPWSCHPDDVMFAQQAMRERHLFGDVHLRGYYPSYIVKEWQRKGYQIEMQPGDEQALR
EGCADYLGFSYYMSNAVQFSARDSDDGRHIEGFPGSRPNPHVKASDWGWQIDPVGLRYTL
NAFWERYQKPMFIVENGFGAYDKMEADGQINDDYRIAYLQAHIEQMKIAVLEDGVELMGY
TPWGCIDCVSFTTGQYDKRYGFIHVNKNDDGSGDLARSKKKSFNWYKQVIASNGEDL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaccaaacgattttttatggggcggtgcggttgcggcgcatcaggttgaaggc
ggctgggaccagggcggtaaaggtcccagcattgtcgacgttctgtctggcggcgcgcac
ggtgtggatcgcgtgattaccgacggtgttgatgcagcgcatcactatcctaaccatcag
gcggtggatttctatcatcgttacaaagaagacatcgcgctgtttgccgaaatgggcttt
aagtgtttccgcacctcgattgcctggacgcgcatcttcccgcagggcgacgagctggag
ccgaacgaagccggtttacaattctacgatgacctgttcgacgaattgctgaagtacaat
atcgaaccggtgatcaccctttcccacttcgagatgccacagcatctggtgaaagagtac
ggtggctggctgaaccgcaacgtggttgatttctttgtgcgctacagcgaagtggtgctg
aaacgctatcagcacaaagtgaaatactggatgacctttaacgagatcaataaccagcgc
aactggcgttatccgctgttcggctactgcaactccggggtgattttcaccgatcatgag
aagccggagcaggcgatgtaccaggttctgcatcatcagtttgtcgccagcgcccgggtg
gtgaaactgggtcaccagatcaaccccgatctaaaaatcggctgtatgctggcgattgtg
ccgctctatccctggtcatgccacccggacgatgtcatgttcgcccagcaagcaatgcgc
gagcgccatctgtttggcgatgtgcatctgcgcggctactatccgtcttacatcgtcaaa
gagtggcagcgcaaaggttatcagatcgagatgcagcccggtgacgagcaggcgctgcgc
gagggctgcgccgactatctgggctttagctattatatgagtaacgcggtgcagttctcg
gccagggacagcgacgatggccgccatattgaaggcttccccggcagccgcccgaatcca
catgtgaaagcatccgactggggctggcagatcgatccggtcggcctgcgctacacgttg
aatgccttctgggaacgctatcagaaaccgatgtttatagtggaaaacggctttggcgcc
tacgacaagatggaagccgatggtcagatcaacgacgactaccgcattgcctatttgcag
gcgcatatcgagcagatgaaaatcgcggtgctggaagacggcgtggagctgatgggctac
accccctggggctgcattgactgcgtatccttcaccaccggccagtacgacaagcgctac
ggatttatccacgtcaataaaaacgacgacggcagcggcgacctggcgcgctcaaagaaa
aagagctttaactggtacaagcaggtcattgccagcaacggcgaggatttgtaa

DBGET integrated database retrieval system