KEGG   Erwinia amylovora ATCC 49946: EAM_3077Help
Entry
EAM_3077          CDS       T01199                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eay00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3371867..3372703)
Genome map
AA seq 278 aa AA seqDB search
MKLFARDAVLDLSHPHVMGILNVTPDSFSDGGKHNELIHALTHANEMINAGATIIDVGGE
STRPGAAEVSTEQELDRVIPVVEAIAQRFEVWISVDTSKPEVIHEAARAGAHIINDVRSL
HQPGALAAAAQTGLPVCLMHMQGEPKTMQQSPRYQNVLHDVEAFFVENIARCEAAGIKKS
QLLLDPGFGFGKNLSHNYQLLAHLADLHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGAHILRVHDVKETVEAMRVVEATQSAREK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcgccagagatgccgtgctcgatctctctcatccccatgtgatggggatt
ttgaatgtcactcccgactctttttctgatggcggcaagcataacgaattaattcatgca
ctaacccacgcaaacgagatgattaacgccggcgcaacgattatcgatgtcggcggagag
tccacccgtcccggtgccgcagaggtcagcacggagcaggagctggatcgcgttatcccg
gtggtggaagccatcgctcaacgttttgaagtatggatctcggtcgatacttccaagcca
gaggtgatccacgaagctgcacgggcaggggcacacatcatcaacgatgtacgctcacta
catcaacctggcgcgctggccgctgctgcgcaaacgggtttgccggtgtgcctgatgcat
atgcagggcgaaccaaaaaccatgcagcagtcgccacggtatcagaacgttctgcacgat
gttgaggctttttttgtcgagaatattgcccgctgcgaagcggctgggatcaaaaaatcg
cagttgctgctcgacccgggttttggtttcggtaagaatctctcccacaactatcaactg
ctggcgcatctggccgatttacatcattttggcctgccgctgctggtcggtatgtcgcgt
aaaagtatgattggtcagctactgaacgtggggccatcgcaaagattgaccggtagcctc
gcctgcgcggtgattgccgcgatgcagggcgcccatattctgcgcgtacacgacgtcaaa
gaaaccgtagaggcgatgcgcgttgtcgaagccacacagtccgcaagggaaaaataa

DBGET integrated database retrieval system