KEGG   Erwinia amylovora ATCC 49946: EAM_3256Help
Entry
EAM_3256          CDS       T01199                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eay00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3543655..3545343
Genome map
AA seq 562 aa AA seqDB search
MTIIDRLINEIYDSAFPPARLQQLHALVAAARERICQPRKAHWDQQDVVLIAYADQFHED
NTPTLATFSRFYRQHLQSSFNLVHLLPFFPSSSDDGFAVIDYHQVDPPYGSWQDIAELHQ
HTRLMFDFVCNHMSAHSAWFAHYLAQDPGWDNFFISRPPAADLSAVTRPRTSPLLTPFVM
ANGEARSVWTTFSADQVDLNYADPDVLLSMVTVLLDYLQQGADYLRLDAVGYLWKTPGTA
CIHLAKTHLLVKLFRAIIDEVAAGTVLLTETNVPHDDNIRYFGNGRDEAHMVYQFPLPPL
VLHAIHHGSSRALRQWASSLDGGSGSTTFFNFLASHDGIGLNPLRGILPEHEIVALAQDL
AREGALISWKTNPDGTTSPYEINVTYLDALSKERDDDDSRLQRFLLAHGLLLAFPGVPAV
YVQSILGSRNDLDGVKVAGMNRAINRQKYALSDIEKALAATGSLRQRVWYALSQLIQVRI
RQAAFHPDNPMTIGDSDDSLLVMQRQTKNAQDTLCCVFNLSAKPVGYRLPEPRWYRDVAS
GERIDGKEELVLDAWQFRWLQP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgactattattgatagattaatcaatgagatctatgattccgctttcccgccagcacgc
ctgcaacagctgcacgcgctggttgccgctgcccgcgagcgtatttgccagccgcgcaag
gcgcactgggatcagcaagacgtggtgctgatcgcctacgcggatcagtttcatgaagat
aacacccccaccctggcgaccttctcgcgcttctaccggcaacatttacagtccagcttt
aacctcgttcacctgctgcccttttttccgtcatcgtcggacgatggcttcgcggtgatc
gactatcatcaggtggatccgccttacggcagctggcaggacattgccgaactgcatcag
cacacgcgcctgatgtttgacttcgtctgcaaccatatgtcggcccacagcgcctggttc
gcccactacctggctcaggatcccggctgggataacttttttatcagccggccacccgct
gctgatttaagcgcggtcacccgaccgcgcacttcgccgttgctcacgccgttcgtgatg
gcaaacggcgaggcgcgctcggtctggaccaccttcagcgccgaccaggtcgaccttaat
tatgccgatcctgacgtgctgctcagtatggtcaccgtgctgctggattatttacaacag
ggggcagattacctgcggctggatgcggtaggttacttatggaaaaccccgggtacggcg
tgcatccatttagccaaaacccacctgctggtgaagctgttccgtgccatcatcgacgag
gtggccgcgggaacggtactgctgaccgaaaccaacgtgccgcatgacgacaacatccgc
tatttcggcaacggccgtgatgaagcgcatatggtctatcagtttccgttgccgccgctg
gtgctgcatgccatccaccacggttcatcacgcgcattacgccagtgggcatcctcgctc
gacggcggcagcggcagcaccaccttctttaatttcctcgcctctcatgacggtatcggc
ctgaatccgctgcgcggcattctgcctgaacacgaaatcgtcgcgctggcgcaagacctg
gcgcgggaaggcgcgctgatctcgtggaaaaccaatcctgatggcaccaccagcccttat
gaaatcaacgtcacctacctggacgcgctgagtaaagaacgggacgacgacgatagccgc
ctgcaacgatttttactggctcacgggctgctgctggcttttcccggcgtgccggcggtt
tacgtgcagagcattcttggctcgcgcaatgacctggacggcgtcaaagtcgccgggatg
aaccgggcgattaaccgccagaaatatgcactgagcgacattgaaaaggcgctggccgca
acgggctcgctgcgccagcgagtatggtatgcgctcagtcaactgattcaggtacgcatt
cgtcaggcggcattccatcccgataatcccatgacgattggcgacagcgatgattcgctg
ctggtgatgcaaaggcagacaaaaaatgcacaggatacgctgtgttgcgtgttcaacctg
agcgctaagccggtcggttaccgtctacccgaaccgcgctggtaccgcgatgtcgccagc
ggcgaacggattgatggtaaagaggagctggtgctggacgcatggcaatttcgctggctg
caaccctga

DBGET integrated database retrieval system