KEGG   Erwinia amylovora ATCC 49946: EAM_P224Help
Entry
EAM_P224          CDS       T01199                                 

Definition
DNA methylase
Orthology
K07319  
putative adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
eay  Erwinia amylovora ATCC 49946
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2:13056..13736
Genome map
AA seq 226 aa AA seqDB search
MSRFVQGNCIEIMSGYPEKSVDFILTDPPYLVGFRDRSGRTIAGDITDEWLQPACREMYR
VLKNDALMVSFYGWNRADRFITEWKAAGFTIVGHFVFTKSYTSKSAFVGYQHECAYILAK
GRPRLPENPLSDVQGWQYTGNKHHPTEKPVTSLQPLIESFTHPGAIVLDPFAGSGSTCVA
ALQSGRRYIGIELMEKYHRAGQRRLAAVQHAMQRPAANDSWLPDAA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgttttgtccagggtaactgtatcgaaattatgtccggctatccggaaaagtcc
gtcgactttattctcaccgatccgccgtatctcgtcggattccgcgatcgctccgggcgc
accattgccggcgatatcaccgacgaatggttgcaacccgcctgccgtgaaatgtatcgc
gtgctgaaaaatgacgcgctgatggtcagcttttacggctggaaccgcgccgatcgcttc
atcacggaatggaaagccgccggttttaccattgtgggccacttcgttttcactaagagc
tacacatcaaagtccgcctttgtcggatatcagcacgaatgcgcctatatcctggccaaa
gggcgtccgcgcctgcccgaaaacccgctctcagacgtgcagggatggcagtacacgggc
aacaaacatcatccgactgaaaagccggtcaccagcctgcaaccgctgatcgagtccttc
acacatccgggcgccatcgttctcgatccttttgccggcagcggctccacctgcgtcgcc
gcccttcagtcaggccgccgctatatcggaattgaactgatggagaaataccaccgcgcc
gggcagcgccgcctggcggcggtccagcacgccatgcaacgaccggcggcaaacgacagc
tggctcccggatgcggcgtaa

DBGET integrated database retrieval system