KEGG   Aromatoleum aromaticum: c1A208Help
Entry
c1A208            CDS       T00222                                 

Gene name
fadB
Definition
alpha-subunit of fatty acid oxidation complex
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eba  Aromatoleum aromaticum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    c1A208 (fadB)
   01212 Fatty acid metabolism
    c1A208 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    c1A208 (fadB)
   00650 Butanoate metabolism
    c1A208 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    c1A208 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    c1A208 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    c1A208 (fadB)
   00310 Lysine degradation
    c1A208 (fadB)
   00380 Tryptophan metabolism
    c1A208 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    c1A208 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    c1A208 (fadB)
   00281 Geraniol degradation
    c1A208 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    c1A208 (fadB)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     c1A208 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     c1A208 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     c1A208 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1367049..1369085)
Genome map
AA seq 678 aa AA seqDB search
MMGAHYEHLRLVRDEGDGEGAGDGVAWLHLDCRDAATNTLSRAVLDELAAVFAALEAQPP
KGLVIASAKPAGFIAGADIEEFTRLDSPQAARDLVGRGWELFNRLVRLRFPTLALIRGHC
LGGGLELALACRYRVVVDEPATKLALPEVMLGIVPAWGGMKRLPETIGAPAALDLMLTGK
SVDARRAKQLGLADECVPPRVMENAARMLVLSRQRRRKPPLALRLMNGPLKSVVADRARK
QVASKAPREHYPAPYAIVDIWQRFGGNALAVPAGHPASLEAILRSPTAKNLIRVFFLQER
LKGFGKSDDNSGDLAPRRVHVVGAGVMGGDIAAVCALAGMTVTLQDQAVERIAPAVGRAA
KLFERKLRGDTATKARQVRFALDRLIPDPHGHGARRADVVIEAIFENLDAKRALFAQLER
RARPDAVLATNTSSLRIEDIGAELANPARLVGIHFFNPVAQMPLVEVVAGEASDADALYR
AAAFVRRLDKLPLPVRSAPGFLVNAVLGPYMLEALRCVEEGVAPEAVDAALVAFGMPMGP
VELVDTVGLDIALAAGRALGGGAVAVPKRLAELVAAGHLGRKSGQGYYRWSDGKAQKTPV
DTVPAGLAARIVAPLLAATRRCVDEGVVADADLADAGVIFGTGFAPFTGGPLHYLASVGE
KPLDAASARRDDAIVSAR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggggcgcactacgaacatctgcgcctcgtgcgcgacgagggagatggagagggg
gccggggacggcgtcgcgtggctgcatctggactgtcgcgacgcggcgacgaatacgctg
tcgcgcgcggtgctcgacgaactcgcggccgtgttcgccgcgctcgaagcgcagccgccg
aaagggctcgtcatcgcgtcggcgaaacccgccggtttcatcgccggagccgatatcgag
gaattcacgcgcctcgactcgccgcaggcagcgcgcgatctggtcggccgtggctgggag
ctcttcaaccggctcgtgcgcctgcgctttccgacgctcgcgctgattcgcggccattgc
ctcggcggcgggctggaactcgcgctcgcgtgccgctaccgcgtcgtcgtcgacgagcct
gcgacgaagctcgcgctgcccgaagtgatgctcggcatcgtgcccgcgtggggcggcatg
aagcggctgccggagacgatcggcgcaccggcggcgctcgacctgatgttgaccggaaag
agcgtcgacgcgcgccgcgcgaagcagctcgggctcgccgacgagtgcgtgccgccgcgc
gtcatggagaacgccgcgcgcatgctcgtgctgtcccgccagcggcggcgaaagccgccc
ctcgcgttgcggctgatgaacggtccgctgaagtcggtcgtcgccgaccgggcgaggaag
caggtcgcctcgaaggcgccgcgcgagcattacccggcgccgtacgcgatcgtggacatc
tggcagcgtttcggcggcaacgcgctggcggtgccggccggccatccggcgtcgctcgaa
gcgatcttgcgctcgccgacggcgaagaacctcatccgcgttttcttcctgcaggagcgg
ctgaaaggtttcggcaagagtgatgacaacagcggggacctcgcgccgcgccgtgtgcat
gtcgtcggcgccggcgtcatggggggcgacatcgcggcggtgtgcgcgctcgcgggcatg
acggtgacgctgcaggatcaggccgtcgagcgcatcgcgccggccgtcggccgcgccgcg
aagctcttcgagcgcaagctgcgcggcgacacggcgacgaaagcgcggcaggtgcgcttc
gccctcgaccggctgatcccggacccgcacggccatggcgcgcggcgcgccgatgtcgtc
atcgaggcgatcttcgagaatctcgacgcgaagcgcgcgctgttcgcacagctcgagcgc
cgcgccagacccgacgccgtgctcgcgacgaacacgtcgagcctgcgcatcgaggacatc
ggcgcggaactcgcgaacccggcgcgcctcgtcggcatccatttcttcaacccggtcgcg
cagatgccgctcgtcgaagtcgtcgccggcgaggcgtcggatgccgacgcgctctaccgc
gccgcggcgttcgtccgccgcctcgacaagctgccgctgccggtccgcagcgcgccgggc
ttcctcgtcaacgcggtgctcgggccatacatgctcgaagcgctgcgctgcgtcgaggaa
ggcgtcgcgccggaagccgtcgacgcggcgctggtcgcgttcggcatgccgatgggaccc
gtcgagctcgttgacacggtcggactcgatatcgcgctcgccgccggcagggcgctcggc
gggggcgcagtcgcagtgccgaaacggctcgcggagctcgtcgccgccggccatctcggc
aggaagtccggccagggctattaccgctggagcgacggcaaggcgcagaaaaccccggtc
gacactgtccccgcggggctcgccgcgcgcatcgtcgcaccgctcctcgccgcgacgcga
cgatgcgtcgatgaaggcgtcgtcgccgatgcggatctcgccgatgccggcgtgatcttc
ggcaccggcttcgcgcctttcaccggcggcccgctgcactatctggcgtccgtcggggaa
aaaccgctcgacgcggcatcggcgcgccgggatgatgctatcgtttcggcccgatga

DBGET integrated database retrieval system