KEGG   Aromatoleum aromaticum: c1A212Help
Entry
c1A212            CDS       T00222                                 

Gene name
fadA
Definition
(GenBank) Beta-subunit of fatty acid oxidation complex, 3-keto-acyl-CoA-thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    c1A212 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    c1A212 (fadA)
   00640 Propanoate metabolism
    c1A212 (fadA)
   00650 Butanoate metabolism
    c1A212 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    c1A212 (fadA)
   00072 Synthesis and degradation of ketone bodies
    c1A212 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    c1A212 (fadA)
   00310 Lysine degradation
    c1A212 (fadA)
   00380 Tryptophan metabolism
    c1A212 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    c1A212 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    c1A212 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    c1A212 (fadA)
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     c1A212 (fadA)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   c1A212 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1369082..1370362)
Genome map
AA seq 426 aa AA seqDB search
MSPGIYIIDGARTPFLKARNGPGPFAASDLATAAGTALLVRQTFAPDELDEVILGCASPS
PDEVNIGRVVALRLGCGHKVPGWTVMRNCASGMQALDSAMMNIRTGRSGLVLAGGVDALS
RAPLLFSDAMVRWLSGWYAAKTVGRKAAALHSFRPADLAPVLGIMKGLTDPVVGQLMGQT
AENLAHRFGISRAAMDEYAVRSHRRVAAAQDGGHLGEIVPLIDRDGMLYKDDDGVRRDSS
VDKLAKLKPFFDRKYGRVTAGNSSQITDGAAWLILASEEAVQRRGLTPVGRIVDCEWAAL
DPAQMGLGPVHAATPLLARHGLGLNDLDAWEINEAFAAQVIACLCAWDDADYCRDELGLD
APLGRLDEERLNVDGGAIAIGHPVGASGARIVLHLVQRLRRDNLARGIASICIGGGQGGA
MLVETV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccccggcatctacatcatcgacggcgcccgcacgccgttcctcaaggcgaggaac
ggccccggaccgttcgccgcgtcggacctcgcgaccgccgccggcacggcgctgctcgtg
cgccagacgttcgcgcccgacgaacttgacgaagtgatcctcggctgcgcaagcccgtcg
ccggacgaagtcaatatcggccgcgtcgtcgcgctgcggctcggctgcggccacaaggtg
ccgggctggaccgtcatgaggaactgcgcgtccggcatgcaggcgctggattcggcgatg
atgaacatccgcaccggccgctcgggcctcgtgctcgcgggcggcgtcgacgcgctatcc
cgcgcgccgctgctgttttccgacgcgatggtgcgctggctgtcgggatggtacgcggcg
aagacggtcggtcggaaagcagctgcgctgcacagcttccgcccggccgatctcgcgccg
gtgctcggcatcatgaaagggctgaccgatccggtcgtcggccagctgatggggcagacg
gcggagaacctcgcgcaccgcttcggcatttcgcgcgccgcgatggacgaatacgcggtg
cgcagccaccgccgcgtcgctgcggcgcaggatggcgggcatctcggcgagatcgtgccg
ctgatcgatcgcgacggcatgctgtacaaggacgacgacggcgtgcggcgcgattcgtcc
gtcgacaagctggccaagctcaagccgttcttcgaccgcaagtacggccgcgtcaccgcc
ggcaacagctcgcagatcaccgatggcgcggcgtggctgatcctcgcgtccgaagaggcg
gtgcagcgccgcggcctgacaccggtcgggcgcatcgtcgattgcgaatgggcagcgctc
gatccggcgcagatggggctcggcccggtgcatgcggcaacaccgctgctcgcgcggcat
ggactcgggctgaacgacctggacgcgtgggagatcaacgaagcgttcgctgcgcaggtc
atcgcgtgcctgtgtgcctgggatgacgccgactactgccgggacgagctcggcctcgac
gctccgctcggccgcctcgacgaggagcgcctgaacgtcgatggtggcgcgatcgccatt
ggccatccggtcggcgcgagtggcgcgcgcatcgtgctgcatctcgtgcagcggctgcgc
cgcgacaatctcgcgcgtggtatcgcgagcatctgcatcggcggcggacagggtggcgcg
atgctcgtggagacggtgtga

DBGET integrated database retrieval system