KEGG   Aromatoleum aromaticum: ebA1052Help
Entry
ebA1052           CDS       T00222                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00010  Glycolysis / Gluconeogenesis
eba00260  Glycine, serine and threonine metabolism
eba00680  Methane metabolism
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
eba01230  Biosynthesis of amino acids
Module
eba_M00002  Glycolysis, core module involving three-carbon compounds
eba_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA1052 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ebA1052 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ebA1052 (gpmA)
Enzymes [BR:eba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ebA1052 (gpmA)
Membrane trafficking [BR:eba04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ebA1052 (gpmA)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ebA1052 (gpmA)
  Exosomal proteins of melanoma cells
   ebA1052 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 GlnE
Motif
Other DBs
NCBI-ProteinID: CAI06677
UniProt: Q5P7N4
Position
complement(617164..617913)
Genome map
AA seq 249 aa AA seqDB search
MYKIVLLRHGESTWNKDNRFTGWTDVDLTEKGVEEARGAGHLLKREGYTFDLAYTSVLKR
ANKTLNIVLEELDSLWLPVEHSWRLNERHYGDLQGLNKAETAAKFGDDQVLVWRRSYDTP
PPPLPEGDERLTSGDPRYASLPRAQFPRTECLKDTVARFVPYWETVIVPNILAGRRILIA
AHGNSLRALIKYLDNISDSEIVGLNIPTAQPLVYELDANLRPIRSYYLADADTIRAAEAA
VAGQGKAKG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaatcgttctgcttcgccatggcgagtctacctggaacaaggacaaccgcttc
accggctggaccgacgtcgatctcaccgagaaaggtgtcgaggaggcccggggagctggc
cacttgctgaagcgagagggctacactttcgacctggcctacacgtcggtactcaagcgt
gccaacaagacgctgaacatcgtcctcgaggaactcgactcgctgtggctgccggtggag
cattcgtggcgcctgaacgaacggcattacggcgacttgcaggggctcaacaaggccgag
accgcagcgaaattcggcgacgaccaggtgctcgtgtggcgccgttcatatgacacgccg
ccgccgccgctgccggagggcgacgaacggctcaccagcggcgacccgcgctatgcttcg
ctgccgcgcgcgcagttcccgcgcaccgaatgcctcaaggatacggtggcgcgcttcgtg
ccgtactgggagacggtgatcgtgccgaacatcctggccggtcgccgcatcctgatcgcg
gcccacggcaacagcctgcgcgcgctgatcaagtatctcgacaacatctcggacagcgaa
atcgtcggcctgaacatcccgaccgcgcagccgctcgtctatgagctggacgcgaatctg
cgcccgatcaggagctactacctcgcggatgccgacacgatccgcgcggccgaggctgca
gtggcgggacagggcaaggcgaagggctga

DBGET integrated database retrieval system