KEGG   Aromatoleum aromaticum EbN1: ebA1165Help
Entry
ebA1165           CDS       T00222                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(675433..676206)
Genome map
AA seq 257 aa AA seqDB search
MSMTRNTLCGRHVAVTRPVGQADSLCEAIAARGGIPVCFPVLAIGAVDGARLDDIATRLD
QFDLAFFVSPNAVQHALTPILARRAWPQRVVVATVGKGSERALAAFGFRSVVAPASGFDS
ESVLALPEFRPEAVRGRRIVIFRGDGGRDLLGETLREHGADVEYVSCYRRFQPDQDPAPL
LDLARRGALDAITLTSSEGVAKLVAIVGAEGLRLLCPVPIFAPHSRIAAHARAAGFVRVV
ETGPGDEGLIRALESHF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatgacgcgcaatacgctctgcggacgtcacgtcgcagtcactcgcccggtgggg
caggccgacagcctgtgcgaggcgatcgctgcacgcggcggcattccggtgtgctttccg
gtgctcgcgatcggcgccgtcgatggcgcacgactcgacgacatagccacccggctcgat
cagttcgatctcgcgtttttcgtcagtccgaacgccgtgcagcacgcgctcacgccgatc
ctcgcgcggcgcgcctggccgcagcgagtggtggtcgcgactgtcggcaaggggagcgag
cgggcgctcgcggcgttcggttttcgctccgtcgtcgcgccggcgagtggtttcgacagc
gagtccgtgctcgcccttccggaattccggcccgaagcggtgcgtggccggcggatcgtg
atcttccgcggcgacggcggtcgcgacctgctcggcgaaaccttgcgcgaacacggcgcc
gacgtcgaatacgtgagctgctatcgccgcttccagcccgaccaggatccggccccgctg
ctcgacctcgcgcggcgcggcgcactcgacgcgatcacgctcaccagcagcgaaggtgtc
gcgaagctcgtcgccatcgtcggcgccgagggcctgcgcctgctgtgcccggtgccgatc
ttcgcgccgcactcgagaattgcggcgcacgcgcgcgcagccggcttcgtgcgtgtcgtc
gaaaccggccccggcgacgaagggctcattcgcgcactcgaatctcatttctag

DBGET integrated database retrieval system