KEGG   Aromatoleum aromaticum: ebA1321Help
Entry
ebA1321           CDS       T00222                                 

Gene name
ech
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eba  Aromatoleum aromaticum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ebA1321 (ech)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ebA1321 (ech)
   00650 Butanoate metabolism
    ebA1321 (ech)
  Lipid metabolism
   00071 Fatty acid degradation
    ebA1321 (ech)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ebA1321 (ech)
   00310 Lysine degradation
    ebA1321 (ech)
   00360 Phenylalanine metabolism
    ebA1321 (ech)
   00380 Tryptophan metabolism
    ebA1321 (ech)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ebA1321 (ech)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ebA1321 (ech)
   00281 Geraniol degradation
    ebA1321 (ech)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ebA1321 (ech)
   00627 Aminobenzoate degradation
    ebA1321 (ech)
   00930 Caprolactam degradation
    ebA1321 (ech)
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ebA1321 (ech)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779487..780263
Genome map
AA seq 258 aa AA seqDB search
MSFQNILVETRGRVGLITLNRPKAMNALNDQVVDEMWEALDHFEADEGIGAIVITGSEKA
FAAGADIGAMANFSHMDAYKGDYITRNWERVKTCRKPVIAAVAGFALGGGCELAMMCDMI
IAADNAKFGQPEIKLGILPGSGGTQRLPRAIGKAKTMDMCLTARLMGAEEAERSGLVARV
VPADKLLDEALAVATEVANFSLPVVMMIKESVNRAFEGSLNEGLLFERRVFHAAFGLDDQ
KEGMAAFVEKRKPDFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtttccagaacatcctcgttgaaacgcgtggccgggtcggcctgatcacccttaat
cgcccgaaggcgatgaacgcgctcaacgatcaggtcgtcgatgaaatgtgggaggcgctc
gaccacttcgaggccgacgagggaatcggcgccatcgtcatcaccggcagcgagaaagct
ttcgccgcaggcgccgatatcggcgcaatggcgaacttttcgcatatggacgcctacaag
ggcgactacatcacgcgcaattgggaacgcgtcaagacctgccgcaagccggtcatcgca
gcggtcgccggcttcgcgctcggcggcgggtgcgaactggcgatgatgtgcgacatgatc
atcgctgccgacaacgccaagttcggccagcccgaaatcaagctcggcatcctgcccggc
tcgggtggcacgcagcgcctgccccgcgcgatcggcaaggcgaaaacgatggacatgtgc
ctcaccgcgcggctgatgggggccgaggaagcagaacgttcgggactcgttgcccgggtg
gtgccggccgacaaactgctcgacgaagcgcttgcggtggccaccgaggtcgccaacttc
tcgctgccggtcgtgatgatgatcaaggaatcagtcaatcgcgccttcgaaggaagcctc
aacgaaggccttctgttcgaacgccgcgttttccatgccgcgttcggcctcgacgatcag
aaggaaggaatggctgccttcgtcgagaaacgcaagcctgacttcaagcaccgctga

DBGET integrated database retrieval system