KEGG   Aromatoleum aromaticum EbN1: ebA135Help
Entry
ebA135            CDS       T00222                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:eba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eba00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:eba00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:eba00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70215..71966
Genome map
AA seq 583 aa AA seqDB search
MSELIEVKVPDIGDYADVPVIELFVKPGDTIKVEDPIATLESDKATMDVPSTAAGVVREV
LVQVGDRVAEGKVLIKVEAAGAENTAAPEAAGNAAAQATPASSGAALEQSEASAPSAASA
ATASAPTPTPTSAPAATGGSTEVRVPDIGDFSDVPVIELFVKVGDTIKVEDSIATLESDK
ATMDVPSSAAGVVREVKIKVGDRVSEGAVLIVVDSAAGAATAPAPAATPATARIAAADAT
PADAPEAFEQSKLSAPAAGQAGAPSAVALGGRVHASPSVRAYGRELGVDLAQVRATGPKG
RVVREDVTAFVKGAMQTGIVPGKAAAAGAGVSLGGGLDLLPWPKVDFSKFGEIETKPLSR
IKKISGQNLARNWVMIPAVTYHEDADITDLEAFRVAINKENEKSGKKLTMLAFIIKASVR
ALQQFPEFNTSLDASGGEMSLVYKKYFNIAFAADTPNGLVVPVIKNADRKSVFEIAAESG
ELAKKARDGKLGPADMSGACFTISSLGGIGGTYFAPIVNAPEVAILGVNKSAMKPIWDGK
QFVPRLTLPMSLTADHRVIDGALATRFNVYLAQLLSDFRRVML
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactcattgaagtgaaagtcccggacatcggcgattacgccgacgtcccggtg
atcgagctgttcgtcaagcccggtgacacgatcaaggtcgaggacccgatcgcgacgctc
gagtcggacaaggcgacgatggacgtgccctcgaccgccgccggcgtcgtgcgcgaagtg
ctggtgcaggttggcgaccgcgtggccgaaggcaaggtgctgatcaaggtcgaggcagcc
ggcgccgaaaacaccgctgcaccggaagccgccggcaacgcggcggcgcaggcgacccct
gcgagttccggcgcggcgttggaacagtcggaagcgtccgccccctcggccgcctccgcc
gcaactgcgtcggccccgaccccaaccccgacctccgcccccgccgcaaccggaggcagc
accgaagtgagagtcccggacatcggcgacttctcggacgtcccggtgatcgagctgttc
gtcaaggtcggcgacacgatcaaggtcgaggactcgatcgcgacgctcgaatcggacaag
gcgacgatggatgtgccgtcatcggccgccggcgttgtcagggaagtgaaaataaaagtc
ggcgaccgggtttccgaaggcgcagtgctgatcgtcgttgacagcgccgctggtgcggct
accgcccccgctcccgctgcaacgcccgctaccgcccgcatcgcagccgccgacgcgacg
cccgccgatgcgcccgaggcgttcgagcagtcgaagctgtccgcccctgcggcgggccag
gccggcgccccgtccgcagtggccctcggcggcagggtgcatgcgagcccgtccgtgcgt
gcctacggtcgcgaactcggcgtcgatctcgcccaggtccgcgcgaccggaccgaaaggc
cgcgttgttcgggaggatgtcaccgcgttcgtcaaaggtgcgatgcagaccggcatcgtc
ccgggcaaggcggctgcggccggcgcgggcgtgagtcttggcggcgggctcgatctgctg
ccgtggccgaaagtagatttctcgaagttcggcgagattgaaaccaagccgctgtcgcgg
atcaagaagatctccggccagaacctcgcgcgcaactgggtgatgatcccggcggtcacg
taccacgaggacgccgacatcaccgacctcgaagctttccgcgtcgcgatcaacaaggaa
aacgagaagtccggcaagaagctgacgatgctcgcgttcatcatcaaggcttcggtgcgc
gcgctgcagcagttcccggagttcaacacctcgctcgacgcgagcggtggtgaaatgagc
ctggtctacaagaagtacttcaacatcgcgttcgccgccgacacgccgaacgggctcgtc
gtgccggtcatcaagaacgccgaccgaaagagcgtgttcgagatcgccgccgaatcgggc
gaactcgcgaagaaggcacgcgacggcaaactcggtccggccgacatgtccggcgcgtgc
ttcacgatctctagcctcggcggcatcggtggcacctacttcgcgccgatcgtgaacgcg
cccgaagtcgcgatcctcggtgtcaacaagtcggccatgaagccgatatgggacggcaag
cagttcgtgccgcgtctaaccttgccgatgtcgctgactgccgatcatcgggtcatcgac
ggggcgctcgcgacgcgcttcaacgtctatctcgcccaactcttgtccgacttccgtcgg
gtcatgctgtaa

DBGET integrated database retrieval system