KEGG   Aromatoleum aromaticum: ebA1405Help
Entry
ebA1405           CDS       T00222                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00900  Terpenoid backbone biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01130  Biosynthesis of antibiotics
Module
eba_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ebA1405 (ispE)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ebA1405 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAI06886
UniProt: Q5P725
Position
825391..826245
Genome map
AA seq 284 aa AA seqDB search
MDTAELTRLADCPAPAKLNLFLHVIGRRPDGYHLLQTAFRLLDWGDALSFELRHDGVVAR
ATDLPGVSAEHDLVVRAARLLQSYTGCRLGADIRVDKRLPMGGGLGGGSSDAATTLIALN
RLWRTGVRGEELTALGLRLGADVPFFIFGRDAFAEGVGDELRPLDLPPAWYVVVAPPVTV
PTVEIFAAGELTRDTEPIKITDFAASTTRNDLQAVACSRYPEIGAAIDWLAQFAPARMTG
SGACVFAQVASEDDAERIVASCPGSYRAWKARSVMQHPLRGWVG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgctgaactgacccgtctcgccgattgcccggcgccggcgaagctgaacctc
ttcctgcatgtcatcgggcgccgtccggatggctaccacctgctgcaaacggcgtttcgc
ctgctcgactggggcgacgcgctgtcgttcgagctgcgccatgacggcgtcgtcgcacgc
gccaccgatcttcccggcgtttctgccgagcatgacctcgtcgtgcgcgccgcgcggctg
ctgcagtcatacaccggctgccgcctcggcgccgacatccgcgtcgacaagcgactgccg
atgggtggcggtctcggcggcggcagttcggacgccgcgacgacgctgatcgcgctgaac
cgtctgtggcgcaccggcgtccgcggtgaagagctcaccgcgctcgggctgcggctcggc
gccgacgtcccgtttttcatcttcggccgcgacgcgttcgccgaaggcgtcggcgacgaa
ctgcgcccgctcgacctcccgccagcctggtacgtcgtcgtcgcgccgccggtcacggta
cccaccgtggaaatttttgcagcaggggagttgacgcgggataccgaacccatcaaaatt
acggacttcgcagcgagcaccactcgtaacgatctgcaagcagttgcctgcagccgttat
cccgagatcggtgcagcaatcgactggctggcgcagtttgcgccggcgcgaatgaccggt
tcgggcgcctgcgtatttgcgcaggtggcaagcgaggacgacgccgaacgcatcgtcgca
agctgcccggggtcgtaccgggcatggaaagcgcgcagcgtgatgcagcatccgcttcgt
ggctgggtcggttga

DBGET integrated database retrieval system