KEGG   Aromatoleum aromaticum EbN1: ebA1450Help
Entry
ebA1450           CDS       T00222                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eba00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eba00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(861846..863354)
Genome map
AA seq 502 aa AA seqDB search
MSAARAREILERLRLSGVVAHGITADSRRLQPGELFAAWPGFAADGRRYVAAAIERGAAA
VLWDDSDGMRLEALSVPALPVSGLRSLGGFLAHEIHGCPSSKLWVAGVTGTNGKTTVSQW
LAAALAGLGLRCGVIGTLGCGFPGELVDSGNTTPDALEVHRMLAAFVAESAGAAAMEVSS
IGLDQERVNGVEFDVAVFTNLTRDHLDYHSSMESYAVAKARLFDLPGIGAAVINFDDDFG
LAQARRLAASGMPVIGYTRFVERADAVPGARVLVAASEQNVPSGLRFVLGWDGGHHTVQV
RMVAPFNVSNLMAVIGSLLVRDVPMDDIVRSVSRLTPPAGRMQLVGGVGEPLVVIDYAHS
PDALAQVLEAVRSTAQGRGGRLVCVFGCGGDRDAGKRPMMGDVARALADRVIVTSDNPRS
EDPLKIIDAIVRGAGPNAERIVDRAQAIRIAVGEAGANDVIVLAGKGHEPYQEVLGVRLP
FSDVEQARLAVHAWNRSQGADQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcccgcgcccgtgaaatcctcgaacggctgcggctgtccggtgtcgtcgcg
cacggcatcaccgccgactcgcgtcgcctgcaacccggcgagctgtttgccgcgtggccc
ggattcgcagctgacggccggcgctacgttgccgccgcgatcgagcgcggcgctgccgcg
gtgctgtgggacgacagcgacggcatgcggctcgaagcgctgtcggtgccggccctgccg
gtgtcgggcctgcgcagcctcggcggcttcctcgcgcacgagatccacggctgtccgtcg
agcaagctgtgggtcgccggggtgacggggaccaacggcaagacgacagtgagccagtgg
ctcgccgccgcgctcgccgggctcggcctgcgctgcggcgtcatcggcacgctgggctgc
ggtttccccggcgagctcgtcgatagcggcaacacgacgcccgacgcgctcgaagtgcac
cgcatgctcgccgcgttcgtcgcggagagtgccggcgcggcagcgatggaagtgtcctcg
atcgggctcgaccaggagcgcgtcaatggcgtcgagttcgacgtcgcggtgtttacgaac
ctgacccgcgatcatctcgattaccacagcagcatggaaagctatgccgttgccaaggcg
cggctgttcgacctgccgggcatcggtgctgcggtgatcaatttcgacgacgacttcggc
ctcgcccaggcgcggcggctcgcggcgagcggcatgccggtgatcggctatacgcgcttc
gtcgagcgtgccgacgcggtgccgggcgcgcgcgtgctggtcgccgcgagtgagcagaac
gttccgtcgggcctgcgcttcgtgcttggctgggacggcgggcaccacacagtgcaggtg
cgcatggtcgcaccattcaatgtctcgaacctgatggcggtgatcggatcgctgctggtt
cgcgatgtgccgatggacgatatcgtgcggagcgtgtcgcggctgacgccgcctgccggg
cgcatgcagctggtgggcggcgtcggcgagccgctggtggtcatcgactacgcgcactcg
cccgacgcgctcgcccaggtgctcgaagcggtgcgcagcacggcgcaggggcggggcggg
cgcctggtgtgcgtgttcggctgcgggggtgaccgcgacgcgggcaagcggccgatgatg
ggagatgtcgcgcgcgcgcttgccgaccgcgtcatcgtcaccagcgacaacccgcgcagc
gaggatccgctgaagatcatcgacgcgatcgtgcggggcgctggtcccaacgccgaacgg
atcgtcgatcgcgcccaggcgatccgcatcgcggtcggcgaagcgggagccaacgacgtg
atcgtgctcgccggcaaggggcatgagccttaccaggaggtgctgggcgtgcgcttgccg
ttctccgacgtcgagcaggcgcgacttgcggtgcatgcatggaatcgaagccagggagca
gaccaatga

DBGET integrated database retrieval system