KEGG   Aromatoleum aromaticum: ebA172Help
Entry
ebA172            CDS       T00222                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00010  Glycolysis / Gluconeogenesis
eba00620  Pyruvate metabolism
eba00640  Propanoate metabolism
eba00680  Methane metabolism
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA172 (acsA)
   00620 Pyruvate metabolism
    ebA172 (acsA)
   00640 Propanoate metabolism
    ebA172 (acsA)
  Energy metabolism
   00680 Methane metabolism
    ebA172 (acsA)
Enzymes [BR:eba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ebA172 (acsA)
Lipid biosynthesis proteins [BR:eba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ebA172 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAI06219
UniProt: Q5P8Z0
Position
complement(103300..105288)
Genome map
AA seq 662 aa AA seqDB search
MNMSNEQQQTRARIYKPSEEMVKNAAVSGMEGYLALCKEAEDNYEGFWARHARELVEWKK
PFTQVLDESDAPFFKWFADGQLNVSYNCLDRNVNNGLGDKVAIIFEADSGEVTRVTYKDL
LVRVSRFANALRGMGVKKGDRVVIYLPMSIEGVVAMQACARIGATHSIVFGGFSAQALRD
RINDAGAVALITSDGQHRGGKALPLKPIADEALAMGGCESIRNVIVVKRTGAEVAMDKGR
DQWFDDVCATQSETCEPEWVDAEHPLFLLYTSGSTGKPKGVQHSTGGYLLHAIMSMKYTF
DIKPDDVFWCTADIGWVTGHTFITYGPLACGTTEIVFEGVPTYPDAGRFWKMIQDHKVTV
FYTAPTAIRSLIKAADNNPAVHPKKYDLSSLRILGSVGEPINPAAWEWYYENVGASRCPI
VDTFWQTETGAHMITPMPGATPLVPGSCTLPFPGIQAAVVDETGTELPNGQGGILVVKRP
WPSMIRAVWGDPERYKKSYYPDDFKGQLYLAGDGAIRDKDTGYFTITGRIDDVLNVSGHR
MGTMEIESALVAHEKVAEAAVVGRPDDVTGEAVVAFVVLKGERPTGEQAKAVIKELQNWV
GHEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRQLAKGEEITQDTSTLENPAILDQLGQP
LS
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatgtcgaacgagcaacagcagacccgggcgcgcatctacaagccttcggaagag
atggtcaagaacgcggcggtttccggcatggaaggctaccttgcgttgtgcaaggaggcg
gaagacaactacgaaggattctgggcgcgccacgcccgcgaactggtcgagtggaagaag
cccttcacccaggtcctcgacgagagcgacgcgccgttcttcaagtggttcgccgacggc
cagctgaacgtctcgtacaactgcctcgaccgcaacgtcaataacggtctcggtgacaag
gtcgcgatcatcttcgaagccgacagcggggaagttacgcgcgtcacctacaaggatctg
ctcgtccgtgtcagcaggttcgcgaacgcgctgcgcggcatgggcgtcaaaaaaggcgat
cgcgtcgtcatctacctgccgatgtcgatcgaaggcgtcgtcgcgatgcaggcctgcgcc
cgcatcggcgcgacccactcgatcgtgttcggcggcttctcggcccaggcgctgcgcgac
cgcatcaacgacgccggcgccgtcgccctgatcacgtccgacggtcagcaccgcggcggc
aaggcgctgccgctgaagccgatcgcggacgaggcgctggcgatgggcggctgcgaatcg
atcaggaacgtcatcgtcgtcaagcgcaccggcgcggaagtcgcgatggacaagggccgt
gaccagtggttcgacgacgtctgcgcaacccagtccgagacctgcgagcccgaatgggtc
gacgccgaacatccgctgttcctgctctacacgtcgggctcgaccggcaagccgaaaggc
gtccagcactcgaccggcggctacctgctgcacgcgatcatgtcgatgaagtacaccttc
gacatcaagccggacgacgtcttctggtgcaccgccgacatcggctgggtcaccggccac
actttcatcacctacggcccgctcgcctgcggcacgaccgagatcgtcttcgaaggggtg
ccgacctacccggacgcggggcgtttctggaaaatgatccaggaccacaaggtcactgtg
ttctacactgcgccgaccgcgatccgctcgctgatcaaggctgcggacaacaaccctgcg
gtgcacccgaagaaatacgacctgtcgagcctgcgcatcctcggctcggtcggcgagccg
atcaacccggcggcgtgggagtggtactacgagaacgtcggcgcgagccgctgcccgatc
gtcgatactttctggcagaccgagaccggtgcgcacatgatcacaccgatgccgggcgcg
accccgctcgtgccgggctcctgcacgctgccgttcccgggcatccaggcggcggtcgtc
gatgagaccggaaccgagttgccgaatgggcagggcggaatcctcgtcgtcaagcgtccc
tggccgtcgatgatccgtgccgtctggggcgacccggagcgctacaagaagtcctactac
ccggacgacttcaagggccagctgtatcttgccggcgacggcgcgatccgcgacaaggac
accggctacttcacgatcaccggccgcatcgacgacgtgctgaacgtctcgggccaccgt
atggggacgatggagatcgagtccgcactggtcgcacacgagaaagtcgccgaagcggca
gtcgtcggccgccccgacgacgtgaccggcgaagcggtcgtggcattcgtcgtgttgaag
ggcgagcgcccgaccggcgagcaggccaaggcggtcatcaaggagctgcagaactgggtc
ggccacgagatcgggccgatcgcgaagccgaaggacatccgtttcggcgagaacctgccc
aagacccgttcgggcaagatcatgcgtcggctgctgcgtcagctggcgaagggggaggag
atcacccaggatacgtcgaccctcgagaatccggcgatcctggatcagcttggccagccg
ctgagctga

DBGET integrated database retrieval system