KEGG   Aromatoleum aromaticum: ebA1829Help
Entry
ebA1829           CDS       T00222                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ebA1829
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ebA1829
Enzymes [BR:eba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     ebA1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1065302..1066681
Genome map
AA seq 459 aa AA seqDB search
MASGLVSRSLSKVRAMVAGAGGKSSEPSEKVLARIRLQLKECAESLGGEVSTRLRAGRLA
ETYLSLDDAERIAFLRMIALEFGPDPEKIAKAHEAYQAAVGTDRQWDAEAQLRAAMRSSR
IRILTQFNAIPQGVKFLVDLRADLLRFLEQHKELKSLDRELEARLTAWFDVGFLELTRLT
WNSPAALLEKIVQYEAVHEIQSWRDLKNRLGSDRRCYAFFHPRMPQEPLIFVEVALMEEL
ADNVQKLLDENAPAADTGRATTAIFYSISATQEGLRGVSFGNFLLKRVLDDLKRDFPKLD
TFATLSPLPGLVRWASKHPDEVAAAFTEADWKRLAAIGIEGAESERLKPVLAGSHEWVAD
RSLARALRDPLLRTAAAYLLGGRRDRKAIDPVARFHLGNGARIERLNWLADTSDKGLDQS
WGIMVNYLYDPDRIVTNVETFTASGEIDAAAGVKRLARR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtggcatccggacttgtttctcgcagcctgtcgaaagtgcgcgcgatggtcgccggagca
ggaggaaaaagcagcgagccgtcggaaaaagtgctcgcgcgcatccggctgcaactgaag
gaatgcgccgagagcctgggcggtgaagtgtcgacgcggctgcgcgcaggccgtctcgcc
gaaacttatctgagcctcgacgatgcggaacggatcgcattcctgcgcatgatcgcgctc
gagttcggacctgatccggaaaaaattgcgaaagcgcacgaagcgtatcaggccgcagtg
gggacggaccggcaatgggacgccgaagcccagctgcgcgccgcaatgcgctcgtcgcgg
atccgcatcctgacccagttcaatgcgattccgcagggcgtgaagttcctcgtcgacctg
cgcgcggacctgcttcgctttctcgagcaacacaaggaactcaagtcgctcgatcgcgaa
ctcgaagcgcgcctgacggcgtggttcgacgtcggctttctcgagctcacgcggctcacg
tggaattcccccgccgcgctgctcgagaaaatcgtccagtacgaggcggtgcacgagatc
cagtcgtggcgggacctgaagaaccggctcggctccgaccgtcgctgctacgcattcttc
cacccgcggatgccgcaggagccgctgatcttcgtcgaagtcgcgctgatggaggaactc
gccgacaacgtgcagaaacttctcgacgaaaacgctccggcagccgacaccggtcgcgcc
accaccgcgatcttctattcgatcagcgctacccaggaagggctgcgaggcgtgtctttc
ggcaatttcctgctcaagcgcgtcctcgacgatctcaagcgcgactttccgaaactcgac
actttcgccacgctctcgccgcttccgggactggtgcgctgggcgtcgaagcacccggac
gaagtcgccgcggccttcaccgaggccgactggaagcgcctggccgcgatcggcatcgag
ggagcggagtcggagcgcctcaagccggtgctggcggggagccatgaatgggttgccgac
aggtccttggcgcgggcgttgcgcgatccgctgctgcggaccgctgcagcttacctgctc
ggcggccggcgagacaggaaggcgatcgatccggttgcccgcttccatctgggcaacgga
gcccgcatcgagcggctgaactggctcgcagacacctcggacaagggactcgaccagtcg
tggggaatcatggtcaattatctctatgaccccgaccgcatcgtgacgaacgtcgagact
ttcaccgccagcggggaaatcgacgcggctgcgggcgtgaagcggcttgcgcggcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system