KEGG   Aromatoleum aromaticum EbN1: ebA2146Help
Entry
ebA2146           CDS       T00222                                 

Definition
regulatory protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:eba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:eba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258461..1261406
Genome map
AA seq 981 aa AA seqDB search
MSEQNFDSDDRDAPVLPAAFPIVGIGASAGGLEAFNEFLDHLAPDLGMAYVLVQHLDPAH
HSILANLLAGRTRMPVSEAGDNMRVEPNHIYVIPPNTNLAILGGVLHLMPPAEMRAPQLT
VDYFLRSLAQDQGSQAIGVILSGAASDGVTGMKMIKTEGGITFAEDQNSARYSSMPDAAI
ASGCVDFVLPPAEIADELARLAGRVAATPREAPAVPADDEGHLDKLFILLRRRTGVDFAQ
YKHTTIHRRIQRRMLVHRLDRLADYVRLLHERPAEIDTLYNEILINVTAFFRDPAVFDAL
AREILPKIIERCAGSGDPVRIWVPGCSTGEEPYSIAIALLECMEKADLHLPIQIFATDID
THAINTARAGVFPDSIAADVSPARLARHFTHDEQGYLISKQIRDMCLFAKQNVVKDPPFS
RLDLISCRNLLIYLGPVLQKKVLALFHYALKPAGFLLLGSAETVGKHADMYRTLDTKHKI
YVKKALAATLQFDFSAPLSASFRLADPVARERTAPPLAGRDLAKAVDRLLMKKYCPGSVV
INEQMDIVQFRGQTGEFLEPAPGEASFNLLRMARGALAMELREIVGEALRKRAVVRKEGI
ALRRNDVTLLVEVEVSPLESAALGFFLVVFRATCGMPLAPESASTPGAQHEERLARLEHE
LAATHEYLQSVIEQDETINEELRSANEEILSSNEELQSTNEELETAKEELQSVNEELSTV
NEELETRNRELSQLNNDLSNLLGSVNVPIVILGTDLRIRRYTPLAGKKLNLDDRDLGRAL
GDVELGIRAPDLPQLVAHVIDTVTQQEIEGQARDGRWYSIRVRPYKTIESRIEGAVVAFV
DIDDTRRALRMAQEARDYAQGIVNAIRHPLLVLDKNLKVVSANPAFLDTFQVAQAETVGN
LLYHLGNGQWGIPQLRKALEGVCTRSEGFEDFVVEHEFETIGPRRLRISGRPIDAAAGPP
FLALMQIEAGTDDHGVTRDKE
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagaacttcgactccgacgatcgcgacgcgcccgtgctgcccgccgcgttc
ccgatcgtcggcatcggcgcttcggccggcggcctcgaagccttcaacgagttcctcgac
catcttgcgccggacctcggcatggcttacgtgctggtccagcatctggacccggcgcac
cacagcatcctcgccaacctgctcgcggggcgcacgcgcatgccggtcagcgaggcgggc
gataacatgcgggtcgagccgaatcacatctacgtgatcccgccgaacaccaatctggca
atcctcggcggcgtgctgcacctgatgccgcctgccgagatgcgggcaccgcagctgacg
gtggattatttcctgcgctcgctcgcgcaggaccagggcagccaggcgatcggcgtcatc
ctgtcgggtgccgcgtcggacggcgtgaccggcatgaagatgatcaagaccgaaggcggc
atcacgttcgccgaggaccagaacagcgcccgctacagcagcatgccggacgcggcgatc
gccagcggctgcgtcgatttcgtgctgcctccggccgaaatcgccgacgaactcgcgcgt
ctcgccgggcgggtggccgcgacgccgcgcgaggcgccggccgttcccgccgacgacgag
gggcacctcgacaagctcttcatcctgctgcgccggcgcaccggcgtcgacttcgcgcag
tacaagcacacgacgatccaccgccgcatccagcgccgcatgctcgtccaccggctcgac
cggctcgccgactacgtcaggctgctgcacgagcgaccggccgagatcgacacgctctac
aacgagatcctgatcaacgtcaccgcgttctttcgcgacccggccgtgttcgacgcgctg
gcgcgcgaaatcctgcccaagatcatcgagcgctgcgccggcagcggcgacccggtccgc
atctgggtgccgggctgctcgaccggtgaggagccgtattcgatcgcgatcgcgctgctc
gaatgcatggagaaagccgacctccacctgccgatccagatcttcgcgaccgacatcgac
acccacgcgatcaacaccgcgcgtgccggcgtgttccccgacagcatcgccgccgacgtg
tcgccggcgcggctcgcgcgccacttcacgcacgacgagcagggctatctgatcagcaag
cagatccgcgacatgtgcctgttcgcgaaacagaacgtcgtcaaggacccgccgttctcg
cgcctcgacctgatcagctgccgcaacctcctgatctacctcggtccggtgctgcagaag
aaagtgctggcgctgttccactacgcgctcaagccggccggtttcctgctgctgggcagc
gccgagaccgtcggcaagcacgccgacatgtaccggacgctcgacacgaagcacaagatc
tacgtcaagaaggcgctcgcggcgacgctgcagttcgacttttccgcaccgctatcggcg
tcgttcagactcgccgacccggtcgcgcgcgaacggaccgcgccgccgctcgccggccgc
gacctggcgaaggccgtcgaccggctgctgatgaagaagtactgcccggggagcgtcgtc
atcaacgagcagatggacatcgtgcagttccgcggccagaccggcgagtttctcgaaccg
gcgccgggcgaagcgagtttcaacctgctgcggatggcgcgcggcgcgctcgcgatggag
ctgcgcgagatcgtcggcgaagcgctcaggaagcgcgccgtggtgcgcaaggaaggcatc
gcattgcggcgcaacgacgtaacgctgctcgtcgaagtcgaagtgtcgccgctcgaatcc
gccgcgctgggtttctttctcgtcgtcttccgtgcaacgtgcggcatgccgcttgctccg
gagagcgcgagcacacccggcgcgcagcacgaggaacgcctggcgcggctcgaacacgag
ctggcggcgacccacgaatacctgcagtcggtgatcgagcaggacgagacgatcaacgag
gaactgcgctcggccaacgaggagatcctgtcgagcaacgaggaactacagagcaccaat
gaagagctcgaaacagccaaggaagagctgcagtcggtcaacgaggagttgtccaccgtc
aatgaagaactggaaacgcgcaaccgcgagctgtcgcagctcaacaatgacctgtccaac
ctgctcggcagcgtcaacgtcccgatcgtgatcctcggcaccgacctgcgcatccgccgc
tacacgccgctggccgggaagaaactgaatctcgatgaccgggacctcgggcgcgcgctc
ggcgacgtcgaactcggcatccgggcgccggatctgccgcagctcgtcgcgcacgtcatc
gataccgtcacgcagcaggagatcgaaggccaggcgcgcgacgggcgctggtattcgatc
cgcgtgcggccgtacaagacgatcgagagccgcatcgaaggcgcggtcgtcgccttcgtc
gacatcgacgacacgcggcgcgcgctgcggatggcgcaagaggcccgcgactacgcgcaa
ggcatcgtcaacgcgatccgccacccgttgctggtgctcgacaagaacctcaaggtggta
tccgcgaacccggcgtttctcgacacgttccaggtcgcccaggcggagacggtcggcaat
ctcctttaccatctgggcaacggccagtgggggatcccgcagctgcgcaaggcactcgaa
ggggtatgcacgcgcagcgaggggttcgaggatttcgtcgtcgagcatgagttcgagacc
atcgggccgcgacgcctgcgcatcagcggccggccgatcgatgcggcagccggcccgccg
tttctcgcgctgatgcagatcgaggccggcaccgatgaccacggcgtcacgcgagacaag
gagtag

DBGET integrated database retrieval system