KEGG   Aromatoleum aromaticum: ebA2146Help
Entry
ebA2146           CDS       T00222                                 

Definition
(GenBank) probable regulator protein containing CheR-and CheB-like domains
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
eba  Aromatoleum aromaticum
Pathway
eba02020  Two-component system
eba02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ebA2146
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ebA2146
Enzymes [BR:eba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     ebA2146
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ebA2146
Two-component system [BR:eba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ebA2146
Bacterial motility proteins [BR:eba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ebA2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 CheR_N PAS_4 IncA PAS_8 PAS Spc7 HMMR_N WEMBL FimP Fez1 Exonuc_VII_L HAUS-augmin3 IFT57 APG6 DUF812 ATG16 TerB_C TMF_TATA_bd LMP Med30 Mod_r Atg14 TPR_MLP1_2 Fmp27_WPPW Snapin_Pallidin DUF3584 HemX Golgin_A5 LXG Methyltransf_12 V_ATPase_I Baculo_PEP_C Laminin_II FapA Dna2 DUF1664 TMPIT COG2 COG5 FliJ TBPIP AAA_13 CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: CAI07315
UniProt: Q5P5U7
Position
1258461..1261406
Genome map
AA seq 981 aa AA seqDB search
MSEQNFDSDDRDAPVLPAAFPIVGIGASAGGLEAFNEFLDHLAPDLGMAYVLVQHLDPAH
HSILANLLAGRTRMPVSEAGDNMRVEPNHIYVIPPNTNLAILGGVLHLMPPAEMRAPQLT
VDYFLRSLAQDQGSQAIGVILSGAASDGVTGMKMIKTEGGITFAEDQNSARYSSMPDAAI
ASGCVDFVLPPAEIADELARLAGRVAATPREAPAVPADDEGHLDKLFILLRRRTGVDFAQ
YKHTTIHRRIQRRMLVHRLDRLADYVRLLHERPAEIDTLYNEILINVTAFFRDPAVFDAL
AREILPKIIERCAGSGDPVRIWVPGCSTGEEPYSIAIALLECMEKADLHLPIQIFATDID
THAINTARAGVFPDSIAADVSPARLARHFTHDEQGYLISKQIRDMCLFAKQNVVKDPPFS
RLDLISCRNLLIYLGPVLQKKVLALFHYALKPAGFLLLGSAETVGKHADMYRTLDTKHKI
YVKKALAATLQFDFSAPLSASFRLADPVARERTAPPLAGRDLAKAVDRLLMKKYCPGSVV
INEQMDIVQFRGQTGEFLEPAPGEASFNLLRMARGALAMELREIVGEALRKRAVVRKEGI
ALRRNDVTLLVEVEVSPLESAALGFFLVVFRATCGMPLAPESASTPGAQHEERLARLEHE
LAATHEYLQSVIEQDETINEELRSANEEILSSNEELQSTNEELETAKEELQSVNEELSTV
NEELETRNRELSQLNNDLSNLLGSVNVPIVILGTDLRIRRYTPLAGKKLNLDDRDLGRAL
GDVELGIRAPDLPQLVAHVIDTVTQQEIEGQARDGRWYSIRVRPYKTIESRIEGAVVAFV
DIDDTRRALRMAQEARDYAQGIVNAIRHPLLVLDKNLKVVSANPAFLDTFQVAQAETVGN
LLYHLGNGQWGIPQLRKALEGVCTRSEGFEDFVVEHEFETIGPRRLRISGRPIDAAAGPP
FLALMQIEAGTDDHGVTRDKE
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagaacttcgactccgacgatcgcgacgcgcccgtgctgcccgccgcgttc
ccgatcgtcggcatcggcgcttcggccggcggcctcgaagccttcaacgagttcctcgac
catcttgcgccggacctcggcatggcttacgtgctggtccagcatctggacccggcgcac
cacagcatcctcgccaacctgctcgcggggcgcacgcgcatgccggtcagcgaggcgggc
gataacatgcgggtcgagccgaatcacatctacgtgatcccgccgaacaccaatctggca
atcctcggcggcgtgctgcacctgatgccgcctgccgagatgcgggcaccgcagctgacg
gtggattatttcctgcgctcgctcgcgcaggaccagggcagccaggcgatcggcgtcatc
ctgtcgggtgccgcgtcggacggcgtgaccggcatgaagatgatcaagaccgaaggcggc
atcacgttcgccgaggaccagaacagcgcccgctacagcagcatgccggacgcggcgatc
gccagcggctgcgtcgatttcgtgctgcctccggccgaaatcgccgacgaactcgcgcgt
ctcgccgggcgggtggccgcgacgccgcgcgaggcgccggccgttcccgccgacgacgag
gggcacctcgacaagctcttcatcctgctgcgccggcgcaccggcgtcgacttcgcgcag
tacaagcacacgacgatccaccgccgcatccagcgccgcatgctcgtccaccggctcgac
cggctcgccgactacgtcaggctgctgcacgagcgaccggccgagatcgacacgctctac
aacgagatcctgatcaacgtcaccgcgttctttcgcgacccggccgtgttcgacgcgctg
gcgcgcgaaatcctgcccaagatcatcgagcgctgcgccggcagcggcgacccggtccgc
atctgggtgccgggctgctcgaccggtgaggagccgtattcgatcgcgatcgcgctgctc
gaatgcatggagaaagccgacctccacctgccgatccagatcttcgcgaccgacatcgac
acccacgcgatcaacaccgcgcgtgccggcgtgttccccgacagcatcgccgccgacgtg
tcgccggcgcggctcgcgcgccacttcacgcacgacgagcagggctatctgatcagcaag
cagatccgcgacatgtgcctgttcgcgaaacagaacgtcgtcaaggacccgccgttctcg
cgcctcgacctgatcagctgccgcaacctcctgatctacctcggtccggtgctgcagaag
aaagtgctggcgctgttccactacgcgctcaagccggccggtttcctgctgctgggcagc
gccgagaccgtcggcaagcacgccgacatgtaccggacgctcgacacgaagcacaagatc
tacgtcaagaaggcgctcgcggcgacgctgcagttcgacttttccgcaccgctatcggcg
tcgttcagactcgccgacccggtcgcgcgcgaacggaccgcgccgccgctcgccggccgc
gacctggcgaaggccgtcgaccggctgctgatgaagaagtactgcccggggagcgtcgtc
atcaacgagcagatggacatcgtgcagttccgcggccagaccggcgagtttctcgaaccg
gcgccgggcgaagcgagtttcaacctgctgcggatggcgcgcggcgcgctcgcgatggag
ctgcgcgagatcgtcggcgaagcgctcaggaagcgcgccgtggtgcgcaaggaaggcatc
gcattgcggcgcaacgacgtaacgctgctcgtcgaagtcgaagtgtcgccgctcgaatcc
gccgcgctgggtttctttctcgtcgtcttccgtgcaacgtgcggcatgccgcttgctccg
gagagcgcgagcacacccggcgcgcagcacgaggaacgcctggcgcggctcgaacacgag
ctggcggcgacccacgaatacctgcagtcggtgatcgagcaggacgagacgatcaacgag
gaactgcgctcggccaacgaggagatcctgtcgagcaacgaggaactacagagcaccaat
gaagagctcgaaacagccaaggaagagctgcagtcggtcaacgaggagttgtccaccgtc
aatgaagaactggaaacgcgcaaccgcgagctgtcgcagctcaacaatgacctgtccaac
ctgctcggcagcgtcaacgtcccgatcgtgatcctcggcaccgacctgcgcatccgccgc
tacacgccgctggccgggaagaaactgaatctcgatgaccgggacctcgggcgcgcgctc
ggcgacgtcgaactcggcatccgggcgccggatctgccgcagctcgtcgcgcacgtcatc
gataccgtcacgcagcaggagatcgaaggccaggcgcgcgacgggcgctggtattcgatc
cgcgtgcggccgtacaagacgatcgagagccgcatcgaaggcgcggtcgtcgccttcgtc
gacatcgacgacacgcggcgcgcgctgcggatggcgcaagaggcccgcgactacgcgcaa
ggcatcgtcaacgcgatccgccacccgttgctggtgctcgacaagaacctcaaggtggta
tccgcgaacccggcgtttctcgacacgttccaggtcgcccaggcggagacggtcggcaat
ctcctttaccatctgggcaacggccagtgggggatcccgcagctgcgcaaggcactcgaa
ggggtatgcacgcgcagcgaggggttcgaggatttcgtcgtcgagcatgagttcgagacc
atcgggccgcgacgcctgcgcatcagcggccggccgatcgatgcggcagccggcccgccg
tttctcgcgctgatgcagatcgaggccggcaccgatgaccacggcgtcacgcgagacaag
gagtag

DBGET integrated database retrieval system