KEGG   Aromatoleum aromaticum EbN1: ebA2148Help
Entry
ebA2148           CDS       T00222                                 

Gene name
cheB
Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:eba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:eba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1263678..1264808
Genome map
AA seq 376 aa AA seqDB search
MSSTSFSHFRVIVIGASAGGVEALCNITRALPENFPAAVFVVLHLSRDSPSMLPDILSRA
GPLPANRAVDGEPIRSGRIYVAPPDFHLLIERDQVRMSRGPRENNVRPAIDPLFRSAAIA
YGSAVIGVVLTGNLYDGAAGLRSIKLRGGTTVVQDPRDALFPSMPQSALRETEIDHCVPL
HEIPRVLVSLAKPLPAGAEVGAPSQGLQPCLPSGPPAVSNPQSRQTNMAKTKNAKTSMAT
TEIDVVEAKIAEGNADSEALLRQIASPAPYVCPECHGALWEIRDDGLIRFRCRVGHAYTL
ESLLTEQDEAIEEALWTAVRALEERATLNARMAERIEQQQLSGFVQHFRDRERESTHHAQ
VVRRLLQGGIDKLAPK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcacgagcttttcgcattttcgcgtgatcgtcatcggtgcttcggccggaggg
gtcgaggcgctgtgcaacattacgcgcgcgttgccggagaattttccggccgccgtcttc
gtcgtcctgcatttgtcgcgcgacagcccttcgatgctgccggacatcctgtcgcgtgcc
ggcccgctgccggcgaaccgcgctgtcgatggcgagccgatccgttcggggcgcatctac
gtcgcgccgccggatttccacctcctgatcgagcgcgaccaagtgcgcatgtcgcgagga
ccgcgcgagaacaacgtgcggccggcgatcgatccgctgttccgcagcgcggcgatcgcc
tatggttcggccgtgatcggcgtcgtcctcaccggcaacctgtacgacggcgcagccggc
ctgaggtcgatcaagctgcgcgggggcaccacggttgtccaggatccgcgcgacgcgctt
ttcccgtcgatgccgcagagcgcgctgcgcgagaccgagatcgaccattgcgtgccgctg
cacgagatcccgcgcgtgctggtgagcctcgcaaagcccctgccggccggcgccgaagtg
ggtgcgccaagccagggcctgcaaccgtgcctgccttccgggccgcccgctgtttcgaat
ccgcaatcacggcaaacgaacatggcgaagacgaagaacgcaaaaacgagcatggcgacg
acggagatcgatgtcgtcgaagcgaagatcgccgagggcaacgccgacagcgaggcgttg
ctgcgccagatcgcgtcaccggcgccctacgtctgcccggagtgccacggggcgttgtgg
gaaatccgcgacgacgggctgatccgctttcgttgccgcgtcggccacgcctacacgctc
gaatcgctgctcaccgaacaggacgaggcgatcgaggaggcgctgtggaccgcagtgcgc
gccctcgaggagcgcgcgacactcaacgcgcggatggccgaacgcatcgaacagcagcag
cttagcgggttcgtgcagcacttccgcgaccgcgagcgagagtcgacccaccacgcgcag
gtggtgcgccggctgctgcaaggcggcatcgacaagctggcccccaaataa

DBGET integrated database retrieval system