KEGG   Aromatoleum aromaticum: ebA2188Help
Entry
ebA2188           CDS       T00222                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00010  Glycolysis / Gluconeogenesis
eba00020  Citrate cycle (TCA cycle)
eba00620  Pyruvate metabolism
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
Module
eba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA2188
   00020 Citrate cycle (TCA cycle)
    ebA2188
   00620 Pyruvate metabolism
    ebA2188
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ebA2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CAI07335
UniProt: Q5P5S7
Position
1286810..1287913
Genome map
AA seq 367 aa AA seqDB search
MKIFKLPDLGEGLQEAEIVEWHVAAGDEIEADRPLLSVETAKAIVEIPSPHSGHIEKLFG
QPGQIVHVGAPLVGFAGTAEDSDTGTVVGEVQVGHQLAPEAPAAVGGGAAAIKATPAVRA
LARQLNVELEMVTPSGPDGLITTADVQRVAKILADVGPPEVLRGVRRAMARNMALAQSEV
AGATVVDDADIDAWLPDSDVTIRLVRALVAGCRAEPALNAWYESHTMGRRVLEKIDVGIA
IDLAEGLFVPVLRDVANRDANDLRRGLDRMRADVIARKIPADELRGNTITLSNFGMIAGK
YAAPIVMPPTVAILGAGRVHQQVLAIDGAPAVRRVLPLSLTFDHRVVTGGEAARFLAAVI
ADLALPE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttcaaactgcccgacctgggcgaaggcctgcaggaagcggagatcgtcgaa
tggcacgtcgcggccggcgacgagatcgaggcggaccggccgctgctgtcggtggagacg
gccaaggcgatcgtcgagatcccttcgccgcattcgggccacatcgagaagctgttcggg
cagccggggcagatcgtgcatgtcggcgcgccgctggtcggctttgccggcaccgccgaa
gacagcgacaccggcaccgtcgtcggtgaagtgcaggtcggccatcagctcgcgccggaa
gctccggcagccgtcggcggcggcgcagcggcgatcaaggcgacgcccgcggtgcgcgcg
cttgcccgccagctcaacgtcgagctcgagatggtcacaccgtccggcccggacggcctg
atcacgacggccgacgtgcagcgggtcgcgaagatcctcgccgacgtcgggccgccggag
gtcctgcgcggcgtgcggcgcgcgatggctcgcaacatggcgctcgcgcaaagcgaagtg
gcgggggcgacggtcgtcgatgacgccgacatcgacgcgtggctgccggacagcgacgtc
acgatccggctcgtgcgcgcgctggttgcgggctgccgggccgagccggcgctcaacgcg
tggtacgagagccacacgatgggacgccgcgtgctcgagaagatcgacgtcggcatcgcg
atcgacctcgccgaaggactgttcgtgccggtgttgcgcgacgtcgcgaaccgcgacgcg
aacgacctgcgccgcggcctcgaccggatgcgcgccgatgtcatcgcgcgcaagatcccg
gccgacgaactgcgcggcaacacgatcacgctgtcgaatttcggcatgatcgccggcaag
tacgccgcaccgatcgtcatgccgccgacggtggcgatcctcggcgccggccgcgtgcac
cagcaggtgctcgcgatcgacggcgcgccggccgtgcgccgcgtgctgccgctgagcctc
acgttcgaccatcgcgtcgtgaccggcggcgaagcagcccggttcctcgccgcggtgatc
gcggacctcgcgctgccggagtga

DBGET integrated database retrieval system