KEGG   Aromatoleum aromaticum EbN1: ebA2722Help
Entry
ebA2722           CDS       T00222                                 

Gene name
recD
Definition
DNA helicase, ATP-dependent dsDNA/ssDNA exonuclease V subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1613354..1615222)
Genome map
AA seq 622 aa AA seqDB search
MNPLDLRLDLTAEAELAHGFAAHAVSWARAAGAPDACLPRLRTAAMRASLAVAAGHVCVP
LAELVAVDETVAGLREALLASGVVGRAAAPEPRPLLLDAADRLYLRRHYDWERRLATALV
ARAASALPAPPPAAVERLGELFAANAARLDGRADWQKLAVALALERRLTVISGGPGTGKT
TTVAALLACLLSAEPELRVALAAPTGKAAARMLDALRARSTSVPEEIRGRLPQTSHTLHR
LLGVTPQPGRFRHHAGNPLALDVLVVDEASMLDLALATRLVDALPPHARLILLGDKDQLA
AVEAGAVFAELCADPSLDTSCVARLATLTDTPAGRIAPPPPRRATPLAGSVVWFAESHRF
AADSGIGRLAAGINAGAGDEVLAWLREGADSSVEWLADDGDAPSAAVLARLEQGYAGYFD
ALRAYDGDPAPVFAAFDRFRVLCAVHGGPRGIDATNERLSRRARAALADAPGLAVSPWYA
GRPVIVLKNDYLLRLYNGDVGICLPDAHGELGVVFPDPAGGWRELAPLRLPAHDTAFAMT
VHKAQGSEFAKVMLLLPAAPVKVMTRELLYTGVTRAAREVVLAGPEAVLLAACATPTRRE
SGLIDRMVEAGNAHRVPPGGPR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctctcgacctgcgcctcgacctgactgccgaagccgagctcgcgcacgggttt
gccgcgcatgccgtgagctgggcgcgcgctgccggcgcgccggacgcgtgcctgccgcgg
ctgcgcacggcagcgatgcgcgcgagcctcgccgtcgccgcggggcacgtgtgcgtgccg
ctcgccgagctcgtcgccgtggacgagacggttgccgggctgcgcgaggcgctgctcgcg
agcggcgtcgtcggccgcgccgcggcgccggagccgcgaccgctgctgctcgacgcggcc
gatcggctgtacctgcgccgccattacgactgggaacggcggctcgcgactgcgctcgtc
gcgcgcgccgcaagcgcgctgccagcgccgccgccggccgccgtcgagcgcctcggcgaa
cttttcgccgccaacgcggcgcggctcgacgggcgtgccgactggcagaagctcgcggtc
gcgctcgcgctcgaacggcgcttgaccgtcatcagcggcgggcccggcaccggcaagacg
acgacggtcgcagcgctgctggcgtgtctcctgagcgccgaacccgaactgcgggtcgcg
ctcgccgcgccgaccggcaaggctgccgcccgtatgctcgacgcactgcgcgcgcgcagc
acctccgtgccggaagagatccgcgggcgcctgccgcagacttcgcacacgctgcaccgc
ctgctcggcgtgacgccgcagcccggccgctttcgccatcacgccggcaatccgcttgcg
ctcgacgtgctggtcgtcgatgaggcgtcgatgctcgatctcgcgctcgcgacgcggctc
gtcgacgcgctgccgccgcacgcgcgcctgatcctgctcggcgacaaggaccagctcgcc
gcggtcgaggccggcgcggtgttcgccgagctgtgcgccgacccgtcgctcgatacttcc
tgcgttgcgcggctcgcgaccttgaccgacacgccggccgggcgcatcgcaccgccgccg
ccgcgccgcgcgacgccgctcgccggcagcgtcgtatggttcgccgaaagccaccgcttt
gccgccgactccggcattggccggctcgccgccggcatcaacgccggcgccggcgacgaa
gtgctcgcatggctgcgcgaaggcgcggactcgtcagtcgaatggctcgcggacgacggc
gatgcgccgtccgctgcggtgctggcacggctggagcagggttatgccggttatttcgac
gcgctgcgcgcgtacgacggcgatccggcgccggtgttcgccgcgttcgaccgttttcgc
gtgctgtgcgcggtgcacggcgggccgcgcggcatcgacgcgacgaacgaacggctgtcg
cgccgcgcgcgcgccgcactcgccgacgcgcccggcctcgctgtgtcgccgtggtatgcg
gggcggccggtgatcgtgctgaagaacgattacctgctgcggctctacaacggcgacgtc
ggcatctgcctgccggacgcgcacggcgagctgggcgtcgtgttccccgaccccgccggc
ggctggcgcgaactcgcgccgctgcgcctgcccgcccacgacaccgcgttcgcgatgacc
gtgcataaggcgcagggctcggagttcgcgaaagtgatgctgttgctgccggcggcgccg
gtgaaagtgatgacgcgcgaactgctctacaccggcgtcacgcgcgccgcgcgcgaagtc
gtgctcgccgggccggaagcggtgctgctcgcggcgtgcgccacgccgacgcggcgcgaa
agcggcctgatcgaccgcatggtcgaagctggcaacgcacaccgggtgccgccgggaggt
ccgcgatga

DBGET integrated database retrieval system