KEGG   Aromatoleum aromaticum EbN1: ebA2814Help
Entry
ebA2814           CDS       T00222                                 

Gene name
smuG
Definition
ssDNA-binding protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:eba03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1674254..1674988
Genome map
AA seq 244 aa AA seqDB search
MTTAPSVRTLIAAARTLAREVDGMRFAPPVSHVYNPLDYAWTIHESYLRRYGAGPKRVLF
IGMNPGPFGMTQTGVPFGEVAAVRDWLGLAGAIGKPAEENPKRPVEGFACPRSEVSGRRL
WGLFRERFGTPEAFFASHFVANYCPLTFFAEGRNLTPDKLPPAESGPLLAACDEHLRRVV
DALEPEWVIGVGAWAESRAAEVLAGRPLRVARILHPSPANPTANRGWAEAATRQLEALDI
WTPS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccccttccgtccgcaccctgatcgccgctgcccgcaccttggcccgggaa
gtcgacggcatgcgcttcgcgccccccgtcagccacgtctacaacccgctcgactacgcg
tggacgatccacgagagctatctgcgccgctatggcgccgggcccaagcgggtgctgttc
atcggcatgaatccgggcccgttcggcatgacccagaccggcgtgccgttcggcgaagtc
gcagcggtgcgcgactggctcgggctggccggcgcgatcggcaaaccagcagaggaaaac
ccgaagcgtccggtcgagggcttcgcgtgcccgcgctccgaagtcagcgggcgccgcctg
tggggactgttccgcgaacgcttcggcacgccggaagcgttcttcgccagccacttcgtc
gccaactactgcccgctgacgtttttcgccgaaggccgcaacctcacgccggacaagctt
ccacccgccgaatccgggccactgctggcggcctgcgacgaacacttgcgccgcgtcgtc
gatgcactggaaccggaatgggtgatcggggtcggcgcctgggcggaaagccgtgccgcg
gaggtgctcgccggccggccgctgcgcgtcgcgcgcatcctccacccgagcccggccaac
ccgacagcgaaccgtggctgggccgaagcggcgacccgccagctcgaagcactcgacatc
tggactccctcctaa

DBGET integrated database retrieval system