KEGG   Aromatoleum aromaticum: ebA2814Help
Entry
ebA2814           CDS       T00222                                 

Gene name
smuG
Definition
ssDNA-binding protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
eba  Aromatoleum aromaticum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:eba00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ebA2814 (smuG)
Enzymes [BR:eba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     ebA2814 (smuG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1674254..1674988
Genome map
AA seq 244 aa AA seqDB search
MTTAPSVRTLIAAARTLAREVDGMRFAPPVSHVYNPLDYAWTIHESYLRRYGAGPKRVLF
IGMNPGPFGMTQTGVPFGEVAAVRDWLGLAGAIGKPAEENPKRPVEGFACPRSEVSGRRL
WGLFRERFGTPEAFFASHFVANYCPLTFFAEGRNLTPDKLPPAESGPLLAACDEHLRRVV
DALEPEWVIGVGAWAESRAAEVLAGRPLRVARILHPSPANPTANRGWAEAATRQLEALDI
WTPS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgccccttccgtccgcaccctgatcgccgctgcccgcaccttggcccgggaa
gtcgacggcatgcgcttcgcgccccccgtcagccacgtctacaacccgctcgactacgcg
tggacgatccacgagagctatctgcgccgctatggcgccgggcccaagcgggtgctgttc
atcggcatgaatccgggcccgttcggcatgacccagaccggcgtgccgttcggcgaagtc
gcagcggtgcgcgactggctcgggctggccggcgcgatcggcaaaccagcagaggaaaac
ccgaagcgtccggtcgagggcttcgcgtgcccgcgctccgaagtcagcgggcgccgcctg
tggggactgttccgcgaacgcttcggcacgccggaagcgttcttcgccagccacttcgtc
gccaactactgcccgctgacgtttttcgccgaaggccgcaacctcacgccggacaagctt
ccacccgccgaatccgggccactgctggcggcctgcgacgaacacttgcgccgcgtcgtc
gatgcactggaaccggaatgggtgatcggggtcggcgcctgggcggaaagccgtgccgcg
gaggtgctcgccggccggccgctgcgcgtcgcgcgcatcctccacccgagcccggccaac
ccgacagcgaaccgtggctgggccgaagcggcgacccgccagctcgaagcactcgacatc
tggactccctcctaa

DBGET integrated database retrieval system