KEGG   Aromatoleum aromaticum: ebA3202Help
Entry
ebA3202           CDS       T00222                                 

Gene name
cpx
Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
eba  Aromatoleum aromaticum
Brite
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ebA3202 (cpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1915362..1916438
Genome map
AA seq 358 aa AA seqDB search
MKQAIQSLLFVGMIGVTASAEAQQWEPLPAQPPIPADNPQTEQKVELGKVLFFDPRLSEH
GTLSCNSCHNVMGSGDDNRPNSIGMHDARGGRSAPTVWNAAFQSAQFWDGRADSLEAQAK
GPITNPIEMGMGSAEVVMERLKSIPGYLPLFKAAFPGSPDPINMDNLAKAIASYERTLIT
PDTPYDRYVKGDKSAFTEQQARGMQTFAELGCTACHSGPNFSGPSLQAGQGFFMKFPTFA
GSKYDDQYDLLLDTGRHAVTKQESDRHLWRVPTLRNIALTAPYLHNGKVETLEEAVVVMA
KTQLNKDVTPAQVKDVVAFLTSLGGSFPAQTMPRLPLTVGVSIVPAVDPHLKTTPLSH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggccattcaatcgctcttattcgtcgggatgatcggtgtaacggcatccgcg
gaggctcagcaatgggagcctctgcccgcacaaccaccaattccagccgacaacccgcaa
accgaacaaaaggttgaactcggcaaggttctgtttttcgatccgcgcctgtccgagcac
ggcacgctttcgtgcaactcctgccacaacgtgatggggagcggggatgacaatcggccg
aactcgatcggcatgcacgatgcccgcggcggacgcagcgcgcccactgtctggaatgca
gcgttccaatcggcgcagttttgggatggtcgcgcggactcgctggaagcgcaggccaag
ggacccatcaccaatcccatcgaaatgggtatgggcagcgccgaggtcgtgatggagcgc
ttgaaaagcattccggggtatcttccattgttcaaagcagcctttcctggctcgccggac
cccatcaatatggataacctggcgaaggcgatcgcgtcatacgagcgcactttgatcact
ccggacacgccttatgatcgttacgtcaagggcgataaatcggcatttaccgaacaacag
gcccgcggcatgcaaacgttcgcagagctgggctgcaccgcctgtcattccggcccgaac
ttcagcggcccgtcgttgcaagccggtcagggttttttcatgaaatttccgacctttgcc
ggcagcaagtatgacgatcagtatgacttgttattggataccggacgccacgcagtcacc
aagcaggagtcggacagacatctgtggcgcgtgcctacattgcgcaatattgcgctgacg
gcaccctatctccacaacggcaaggtggagacgctcgaggaagcagtggtggtgatggcg
aagacacagctgaacaaggacgtaacccccgcgcaagtcaaggatgtagtcgccttcctg
acaagtcttggcgggagttttcccgcgcagaccatgccgcgtcttccgctaacggtggga
gtcagcatcgtgcccgctgtggacccgcacctcaagaccacgcccctgagccactga

DBGET integrated database retrieval system