KEGG   Aromatoleum aromaticum: ebA3494Help
Entry
ebA3494           CDS       T00222                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00230  Purine metabolism
eba01100  Metabolic pathways
Module
eba_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ebA3494 (gmk)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ebA3494 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 MMR_HSR1 cobW NTPase_1 AAA_25 AAA_16 AAA_35 TsaE ABC_tran DUF5053 RsgA_GTPase AAA_23
Motif
Other DBs
NCBI-ProteinID: CAI08094
UniProt: Q5P3M0
Position
2063557..2064204
Genome map
AA seq 215 aa AA seqDB search
MRRLRVGTNEDMPGTLIIITAPSGAGKTTLVSGLLERDPQVNLSVSYTTREPRPGERDGR
EYHFVDVATFRALRDRGEFLEWAEVHGNYYATSKVWLKQQIATGRDILLEIDWQGAQQVR
KSFPDAVGVFILPPSLEELEARLRGRGTDSDDVIMRRLLGARGEMRHVGEFDYVILNNDL
QCALDDLVAVVRASRLRYANQHERHLQYFDFLEQD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcctgcgggtcggcacgaacgaagacatgcccggaaccctgatcatcatcact
gccccgtcgggtgcaggcaaaacgactctcgtcagcggtctgctcgaacgcgatccgcag
gtgaacctgtcggtgtcctacacgacgcgcgagccgcgccccggcgagcgcgacggacgt
gaataccacttcgtcgatgtcgcgacgtttcgcgcgctgcgcgatcgcggcgagttcctc
gaatgggccgaagtgcatggaaactactacgccacttcgaaggtctggttgaagcagcag
atcgcgacggggcgcgatatcctgctcgaaatcgactggcagggtgcgcagcaggtgcgc
aagagctttcccgacgccgtcggcgtgttcatcctgccaccgtcgctcgaggaactggaa
gcccgcctgcgcggacgcggcaccgacagcgacgacgtgatcatgcggcggctgctcggg
gcacgcggcgagatgcgtcatgtcggcgaattcgactacgttatactcaataacgacttg
caatgtgcgctcgacgacctcgtggcggtagtgcgtgcttcgcgcctgcgttatgcaaac
cagcacgagcgccatctgcagtatttcgattttcttgaacaggactga

DBGET integrated database retrieval system