KEGG   Aromatoleum aromaticum EbN1: ebA3888Help
Entry
ebA3888           CDS       T00222                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eba00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2294891..2295565)
Genome map
AA seq 224 aa AA seqDB search
MSPPDTQGADLRAELLATALATSAARLNTGSSGNASVRTRGGMLITPSGLAPESCGADDM
VAMVAGAADGTPTGRLAPSSEWRLHHDLYALRPEAGAIIHAHAPFATALACQRLEIPPFH
YMIARFGGPTVRCAAYATFGTQALSDNISVAMEGRSACLMANHGMLVFGRNLANALALAL
EFESLCEQYWRTRQLGEPVLLSNEEMQEVVERFRWYGRPAEQQP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgccggacacccagggcgcggacctgcgcgccgagctcctcgcgaccgcgctg
gcgacgagtgcggcgcgcctgaacaccggcagctcgggcaatgcgagcgtgcgcacgcgc
ggcggcatgctgatcacgccgagcgggcttgcgcccgaatcatgcggtgccgacgacatg
gtcgccatggtggccggggccgccgacggcacgccgaccgggcggctcgcgccgtcgagc
gaatggcggctgcaccatgacctctacgcgctgcgacctgaagccggcgcgatcatccac
gcacacgcgccgttcgcgaccgcgctggcgtgccagcggctcgagatcccgccgttccac
tacatgatcgcgcgcttcggcggccctaccgtgcgctgcgccgcgtatgcgacgttcggc
acgcaggcgctgtcggacaacatctcggtggcgatggaaggacgcagcgcgtgcctgatg
gcgaaccacggcatgctcgtgttcggccgcaacctcgccaacgcgctcgcgctcgcgctc
gagttcgagagcctgtgcgagcaatactggcgcacgcggcagctcggcgaaccggtgctg
ctgtcgaacgaagagatgcaagaagtcgtcgagcgcttccgctggtacggcaggcccgcg
gaacagcagccgtag

DBGET integrated database retrieval system