KEGG   Aromatoleum aromaticum: ebA3959Help
Entry
ebA3959           CDS       T00222                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eba  Aromatoleum aromaticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ebA3959 (ruvA)
Enzymes [BR:eba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ebA3959 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2333043..2333642)
Genome map
AA seq 199 aa AA seqDB search
MIGRITGILLEKNPPQIVVDTHGVGYEIDVPMSTFYGLPATGESLSLFTHLAIREDGHFL
YGFASADERAAFRQLLKVSGIGARTALSVLSGLSVSDLAQAVALQETGRLVKIPGIGKKT
AERLLLELRDKLGRALPGFGASTVPGAAAQPADSRSDILNALLALGYSDKEAQSALKAIP
PETGVSDGIRQALKLLSKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcaccggcatcctgctggaaaagaacccgccgcagatcgtcgtcgac
acgcacggcgtcggctacgaaatcgacgtgccgatgagcacgttctacggcctgccggcg
accggcgagtcgctctcgctgttcacgcatctggcgatccgcgaggacgggcatttcctg
tacggcttcgcgagcgccgacgaacgcgcggcatttcgccagctgctgaaagtctccggc
atcggcgcgcgcaccgcgctgtcggtgctctccggcctgtcggtcagcgacctcgcccaa
gcggtcgcgctgcaggaaaccggccgcctcgtgaaaattcccggcatcggcaagaaaacc
gccgagcgcctgctgctcgaactacgcgacaagctcggcagggcgctgccaggcttcggc
gcgagcacggttcccggcgccgcagcgcagcccgcggatagccgcagcgacatcctcaac
gcgctgctcgcgctcggctacagcgacaaggaagcgcaatcggcgctgaaagcgatcccg
ccggagacgggcgtctccgacggcatccgccaggcgctgaagctgctgtcgaaagcctga

DBGET integrated database retrieval system