KEGG   Aromatoleum aromaticum EbN1: ebA4099Help
Entry
ebA4099           CDS       T00222                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eba  Aromatoleum aromaticum EbN1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2418231..2418956
Genome map
AA seq 241 aa AA seqDB search
MVERALRPVLVTAFVGMTSLGLAHADEGSVRKAVEGFVGSPVVESVARIPYGELYEVVLK
SGEIVYTDEKMSFLIDGRVIDTSTRRDITQARMAQLSAIDVGTLPLDQAIKQVRGNGKRV
IVSFEDPNCAYCKRLGKELAQLKDVTVYTFLYPILSPDSTEKSRNIWCADDRAKAWSDWI
LNAKVPASASCDSSVVERNVTLGQKLKINGTPTMFLADGRRLGGYLPAAELEQALLEAGK
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacgtgcacttcgtccggtcctggtgaccgcttttgtcggcatgacatcgctg
ggccttgcccacgccgacgaagggagcgtgcgaaaggcagtggaaggatttgtcggttcc
ccggtcgtcgagtcggtcgcgaggattccgtacggcgagctttacgaagtcgtactgaag
agcggggaaatcgtctatacggacgaaaagatgagctttctgatcgacggcagggtgatc
gacaccagtacgcggcgcgatatcactcaggcgcgcatggcgcagctttcggcgatcgac
gtcggcacgcttccgctcgaccaggcgatcaagcaggtaaggggaaacggcaagcgggtc
atcgtctcgttcgaagatccgaattgcgcgtactgcaagcgtctcggcaaggagttggcg
caactgaaggacgtcaccgtctatactttcctgtatccaattctgagtccggattcaacc
gagaagtcacgcaatatctggtgcgccgatgaccgggcgaaggcgtggagcgactggatc
ctgaatgcgaaagtgccggcgtcggcgagttgcgacagttcggttgtcgagcgcaacgtc
acgctcgggcagaagctcaagatcaatggaacgccgacgatgttccttgccgacggtcgg
cggctgggcggctatctcccggcggcagagctggagcaggcgctgctggaagcagggaag
aagtag

DBGET integrated database retrieval system