KEGG   Aromatoleum aromaticum: ebA4109Help
Entry
ebA4109           CDS       T00222                                 

Definition
(GenBank) Pyridoxal-phosphate dependent enzyme
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00260  Glycine, serine and threonine metabolism
eba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01130  Biosynthesis of antibiotics
eba01230  Biosynthesis of amino acids
Module
eba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ebA4109
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ebA4109
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ebA4109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAI08452
UniProt: Q5P2L2
Position
complement(2424783..2426150)
Genome map
AA seq 455 aa AA seqDB search
MTEPTRILLEENEIPTHWYNVVADMPHAPAPSLGADGKPVSPEQMMAIFPTQILEQELSA
ERWIPIPDEVRETYKIWRPSPLMRAVRLERALGTPAKIFFKNEGVSPAGSHKPNSAVPQA
FYNRQAGIKRLATETGAGQWGSSIAFAGQMFGLEVRVYMVKVSYHQKPYRRLMMQTWGAE
VFASPSELTQTGRDALAKDPDNQGSLGLAISEAVEEAASRSDTNYTLGSVLNHVLLHQSI
IGLEAKKQFDKIGLYPDVVLGPCGGGSSFGGIAFPFLADKAAGDKRAQNLRCVAVEPNSC
PTLTKGEYAYDFGDASGFTPMMKMYTLGHDFMPPGIHAGGLRYHGDSPLVSQLYHEGLLE
AVAVPQLATFEAGVLFARTEGIIPAPESCHAIRAAIDEAIKCKETGEPKTILFNLTGHGH
FDMSSYDRYFSGQLENYDYPADAVAASLAHLPKFG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaccgacccgcatcctgctggaagaaaacgagatcccgacgcactggtacaac
gtcgtcgcggacatgccgcacgcgccggcgccatcgctcggcgcggacggcaagccggtc
agcccggagcagatgatggcgatcttcccgacgcaaatcctcgagcaggagctgagcgcc
gagcgctggattccgatccccgacgaagtgcgcgagacctacaagatctggcgccccagc
ccgctgatgcgggcggtgcggctcgaacgggcactcggcactccggcgaagatcttcttc
aagaacgaaggcgtctcgccggcaggttcgcacaagccgaattcggcagtgccgcaggcc
ttttacaacaggcaggccgggatcaagcgcctggcgaccgaaaccggcgccggccagtgg
ggctcgtcgatcgcctttgccgggcagatgttcggcctcgaagtgcgtgtctacatggtg
aaggtcagctaccatcagaaaccgtaccgccggctgatgatgcagacgtggggcgccgaa
gtgttcgccagcccgtccgagctgacgcaaaccgggcgcgacgcgctcgcaaaggacccg
gacaaccagggctcgctcggcctcgcgatctcggaagcggtcgaggaagccgccagccgc
agcgacacgaactacacgctcggctcggtgctcaaccacgtgctgctgcaccagagcatc
atcggcctcgaagcgaagaagcagttcgacaagatcggcctctatcccgacgtcgtcctc
ggcccctgcggcggcggttcgagcttcggcggcatcgcgttcccgttccttgccgacaag
gcggccggcgacaagcgcgcgcagaatctgcgctgcgtcgcggtcgagccgaattcctgc
ccgacgctgacgaaaggcgagtacgcctacgacttcggcgacgcgtccggcttcacgccg
atgatgaagatgtacacgctgggccacgatttcatgcccccgggcattcacgccggaggc
ttgcgctaccacggcgactcgccgctggtctcgcagctctaccacgaagggctgctcgaa
gccgtcgccgtgccccagctcgcgactttcgaagccggcgtgctgttcgcgcgcaccgaa
ggcatcattccggcgcccgaatcgtgccacgcgattcgcgccgcgatcgacgaagcgatc
aagtgcaaggaaaccggcgaacccaagacgatcctgttcaacctgacaggccacggtcac
ttcgacatgagctcctacgaccgctatttctccggccagctcgaaaactacgactatccg
gccgacgcggtggcagcgtcgctggcgcacctgccgaaattcggctga

DBGET integrated database retrieval system