KEGG   Aromatoleum aromaticum: ebA4201Help
Entry
ebA4201           CDS       T00222                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01130  Biosynthesis of antibiotics
eba01230  Biosynthesis of amino acids
Module
eba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ebA4201 (trpC)
Enzymes [BR:eba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ebA4201 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAI08503
UniProt: Q5P2G1
Position
2478308..2479096
Genome map
AA seq 262 aa AA seqDB search
MSDILDKILSVKRDEVAAGSVARPLAQVRAEVEALAAPRNFVGAIRAKIAAGDAAVIAEI
KKASPSKGVIREDFRPAEIALQYERGGAACLSVLTDRQFFQGAPAYLQAARAACSLPVLR
KDFLVDPWQVYEARAMGADAVLLIVAALDLAAMRDMEAVAGSLGMAVLVEAHDAAELDVA
LQLSTPLVGINNRNLRTFDVSLQTTLDLLARVPAGRIVVTESGILAPADVALMRANAVNA
FLVGEAFMRVPDPGEGLRSLFG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctggacaagatcctttcggtcaagcgcgacgaagttgccgccggcagc
gtggcacgccctctcgcgcaggtccgcgccgaagtcgaagcgctcgctgcgccgcggaat
ttcgtcggcgcgatccgcgcgaagatcgccgccggagacgctgcggtgatcgccgagatc
aagaaggcgagcccgtcgaaaggggtgatccgcgaggatttccgccctgccgagatcgcg
ttgcagtacgagcgcggcggcgcggcctgcctgtcggtgctgaccgaccggcagtttttc
cagggggcgccggcgtatctgcaggcggcgcgcgcggcctgcagcctgccggtgctgcgc
aaggatttcctcgtcgacccgtggcaggtgtatgaggcgcgtgcgatgggtgcggatgcg
gtgctgctgatcgtcgcagcgctcgacctcgcggcgatgcgcgacatggaagcggtcgcc
gggagcctcggcatggcggtgctggtggaggcgcacgacgcggccgaactcgatgttgcg
ctgcagctctccacgccgctcgtcggcatcaacaaccgcaacctgcgcacgttcgacgtc
agcctgcagacgacgctcgatctgctcgcgcgcgtcccggccgggcgcatcgtcgtcacc
gagtcgggcatcctcgcgcccgcggacgtcgcgctgatgcgggcgaacgcggtcaatgcc
ttcctcgtcggcgaagcgttcatgcgcgtgccggatccgggtgagggattgcgctcgctg
ttcggctga

DBGET integrated database retrieval system