KEGG   Aromatoleum aromaticum EbN1: ebA4201Help
Entry
ebA4201           CDS       T00222                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eba01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eba00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2478308..2479096
Genome map
AA seq 262 aa AA seqDB search
MSDILDKILSVKRDEVAAGSVARPLAQVRAEVEALAAPRNFVGAIRAKIAAGDAAVIAEI
KKASPSKGVIREDFRPAEIALQYERGGAACLSVLTDRQFFQGAPAYLQAARAACSLPVLR
KDFLVDPWQVYEARAMGADAVLLIVAALDLAAMRDMEAVAGSLGMAVLVEAHDAAELDVA
LQLSTPLVGINNRNLRTFDVSLQTTLDLLARVPAGRIVVTESGILAPADVALMRANAVNA
FLVGEAFMRVPDPGEGLRSLFG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctggacaagatcctttcggtcaagcgcgacgaagttgccgccggcagc
gtggcacgccctctcgcgcaggtccgcgccgaagtcgaagcgctcgctgcgccgcggaat
ttcgtcggcgcgatccgcgcgaagatcgccgccggagacgctgcggtgatcgccgagatc
aagaaggcgagcccgtcgaaaggggtgatccgcgaggatttccgccctgccgagatcgcg
ttgcagtacgagcgcggcggcgcggcctgcctgtcggtgctgaccgaccggcagtttttc
cagggggcgccggcgtatctgcaggcggcgcgcgcggcctgcagcctgccggtgctgcgc
aaggatttcctcgtcgacccgtggcaggtgtatgaggcgcgtgcgatgggtgcggatgcg
gtgctgctgatcgtcgcagcgctcgacctcgcggcgatgcgcgacatggaagcggtcgcc
gggagcctcggcatggcggtgctggtggaggcgcacgacgcggccgaactcgatgttgcg
ctgcagctctccacgccgctcgtcggcatcaacaaccgcaacctgcgcacgttcgacgtc
agcctgcagacgacgctcgatctgctcgcgcgcgtcccggccgggcgcatcgtcgtcacc
gagtcgggcatcctcgcgcccgcggacgtcgcgctgatgcgggcgaacgcggtcaatgcc
ttcctcgtcggcgaagcgttcatgcgcgtgccggatccgggtgagggattgcgctcgctg
ttcggctga

DBGET integrated database retrieval system