KEGG   Aromatoleum aromaticum EbN1: ebA4263Help
Entry
ebA4263           CDS       T00222                                 

Gene name
asnB
Definition
amidotransferase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eba00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2514185..2516113
Genome map
AA seq 642 aa AA seqDB search
MCGIAGLFDLRGKRDFSRDLVRRMNDVQVHRGPDEGGYHFEPGIALAHRRLSIIDLSTGQ
QPLFNEDGSVAVVFNGEIYNFQELVPELEALGHAFHTRSDTEVIVHAWEAWGEDCVQRFR
GMFAFALWDRNRETLFLARDRLAVKPLFYALLPDGTFAFGSELKVLMQHPLLDRRIDAHA
VEEYFALGYVAEPRTIFAGAKKLGAAETLCVRRGQPVPQPRCYWDVHFMLDNPLSLAEAS
AELTARLRESVRLRMIAEVPLGAFLSGGVDSSAVVATMAGLSDEPVHTCSIAFDDPAFNE
SDFAQKVADRYRTNHYVETVKSDDFDLIDTLAGLYDEPYADSSAIPTWRVCQLARKRVTV
ALSGDGGDESFGGYRRYRLHLMEERMRGALPLGVRQPMFGLLGRLYPKADWAPRMFRAKT
TFQALARDSLQAYFHSVSILRDAMRRQLFSNRFRSELAGYNAIEVFRRHAATAHTDDALA
LIQYVDLKTYLVGDINTKVDRASMAHSLEVREPLMDHKLVEWLATLPSGLKVKGQEGKYL
FKKAMEPLLPNDVLYRPKMGFSVPLSRWFRGPLRERVRQTVLGETLAATGIFNPDYLRHL
VDAHQSGARDYSSPLWSLMMFEAFVRSSGGCPARAPELAAAV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtatcgccgggcttttcgaccttcgcggcaagcgcgacttttcccgcgacctc
gtgcgccgcatgaatgacgtgcaggtgcaccgcggcccggacgaaggtggttaccacttc
gagcccggcatcgcgctcgcgcaccgccgcctgtcgatcatcgacctgtccaccggccag
cagccgctgttcaacgaggacggctcggtcgcagtcgttttcaacggcgaaatctacaac
ttccaggaactggtgccggaactcgaagcactcggccacgcctttcacacccgcagcgac
accgaagtcatcgtgcatgcgtgggaggcgtggggcgaggactgcgtgcagcgctttcgc
ggcatgttcgccttcgcgctgtgggaccgcaaccgcgagacgcttttcctggcgcgcgac
cggctcgccgtcaagccgctgttctatgcgctgctgccggacggcacgttcgcattcggt
tccgaactgaaagtgctgatgcagcacccgctgctcgaccgccgcatcgatgcgcacgca
gtcgaagaatattttgcactcggttacgtcgccgaaccgcgcacgattttcgccggggcg
aagaagctgggcgcggccgaaacgctgtgcgtgcggcgcggccagcccgtgccgcagccg
cggtgttactgggacgtgcatttcatgctcgataacccgctgtcgctcgccgaggccagt
gccgaactcaccgcgcggctgcgcgaatccgtgcgcttgcgcatgatcgcggaggtgccg
ctcggcgctttcctgtccggcggtgtcgattcgagcgcagtcgtcgcgacgatggccggc
ctttccgacgaacctgtccacacctgctcgatcgcattcgacgatcccgcattcaacgag
tccgacttcgcgcagaaggtcgcggatcgctaccgcaccaatcattacgtggagacggtg
aagtcggacgatttcgacctgatcgacacgctcgccggactgtatgacgaaccctatgcc
gacagctcggcgatcccgacgtggcgcgtctgccagctcgcgcgcaaacgggtcaccgtc
gcgctgtcgggcgacggcggcgacgagagtttcggcggttaccgccgctaccggttgcac
ttgatggaagagcggatgcgcggggcgctcccgctcggcgtgcgccagccaatgttcggc
ctgctcggccgcctctatccgaaggcggactgggcgccgcgaatgttccgtgcgaagact
acgttccaggcgctcgcgcgggattcgctgcaggcctatttccactcggtgtcgatcctg
cgcgacgcgatgcgtcggcaactgttctcgaaccgcttccgcagcgaactcgccggctac
aacgcgatcgaggtcttccgccgccatgcggcgacggcgcacaccgacgacgcgctggcg
ctgatccagtatgtcgacctcaagacctacctcgtaggcgacatcaacaccaaggtcgat
cgcgccagcatggcgcactcgctcgaagtccgcgagccgctgatggatcacaagctcgtc
gaatggctcgcgaccttgccgtccggcctcaaggtgaaggggcaggaaggcaagtacctg
ttcaagaaggcgatggagccgctgctgccgaacgatgtgctctatcgccccaagatggga
ttttcggtgcccctttcccgctggttccgcgggccgctccgggagcgtgtgcggcagacc
gtgctcggcgagacgcttgcggcgaccgggatattcaacccggattacctgcgccatctc
gtcgacgcgcatcagtccggggcccgcgactacagctcgccgctgtggtcgctgatgatg
ttcgaagccttcgtgcgcagctccggagggtgtcccgcgcgggcgccggagctcgccgcg
gcggtgtga

DBGET integrated database retrieval system