KEGG   Aromatoleum aromaticum: ebA4576Help
Entry
ebA4576           CDS       T00222                                 

Gene name
sdhD
Definition
succinate dehydrogenase,hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
eba  Aromatoleum aromaticum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA4576 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ebA4576 (sdhD)
   00650 Butanoate metabolism
    ebA4576 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ebA4576 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2701322..2701666
Genome map
AA seq 114 aa AA seqDB search
MRLFLGQRAWMLQRVTAVVLLIFLAAAAAMLLAGLPLTYERWYELATSPHGAVLIVVLFA
ALALHGWIGIRDIVLDYIHPPAVRLPLLGLIALVLIAIVIRVALTMAAHFTTAG
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttccttgggcaaagggcgtggatgctgcagcgcgtgacagcggtcgtgctg
ctgatctttctggcggcggctgcggcgatgctgctggctggcttgccgctcacttatgaa
cgctggtatgagctggcgacgagtccgcacggcgcagtgctgatcgtcgtgcttttcgcg
gcgctggccctgcatggctggatcggcattcgcgacatcgtgctcgactacattcacccg
cccgccgtgcggttgccgctgctggggctgatcgcactggtcctgatcgcgatcgtgatc
cgcgtcgcgctgacgatggccgcgcatttcaccaccgccggatga

DBGET integrated database retrieval system