KEGG   Aromatoleum aromaticum: ebA4775Help
Entry
ebA4775           CDS       T00222                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ebA4775 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ebA4775 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ebA4775 (trpB)
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ebA4775 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2825115..2826320
Genome map
AA seq 401 aa AA seqDB search
MADAPYRFPDPSGHFGPYGGVFVAETLIPALDELRAAYEACRDDPAFITEFEYELKHYVG
RPSPIYHARRWSDLLGGAQIYLKREDLNHTGAHKVNNCIGQAMVARRMGKPRVIAETGAG
QHGVATATVAARYGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSKTLKDALNEA
MRDWVTNVHNTFYIIGTVAGPHPYPLMVRDFQTVIGKECLLQMPEMTGRQPDCVIACVGG
GSNAMGIFHPYIDVPDVRLIGVEAAGEGMESGRHAASLTAGKPGVLHGNRTYLLQDDDGQ
IIETHSISAGLDYPGVGPEHAWLKDSGRAEYVTVTDQEALKAFHDLCRLEGIIPALESSH
ALAYAARLAPTLPKDKILLVNLSGRGDKDMHTVAEKSGIQF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgcgccttatcgttttcccgacccgagcggtcactttggtccttacggcggc
gtcttcgttgccgagacgctgataccggcgctggacgaactgcgtgcggcatacgaagcc
tgtcgcgacgacccggcattcatcaccgagttcgagtacgagctcaagcattatgtcggt
cggccgagcccgatctatcacgcccgccgctggtcggacctgctcggcggcgcacaaatc
tacctcaagcgcgaggacctgaaccataccggtgcacacaaggtgaacaactgcatcggc
caggcgatggtcgcgcggcgcatgggcaagccgagggtgatcgccgaaaccggcgcggga
cagcatggcgttgccacggcgacggtcgccgcgcgttacggcatggaatgtgtcgtctac
atggggtcggaggatgtcaggcggcaggctgccaatgtctatcgcatgaagctgctcggc
gccacggtggtgccggtcgagtccggatcgaaaaccctgaaggacgccctcaacgaggcg
atgcgcgactgggtcacgaacgttcacaacaccttctacatcatcggcaccgttgccggg
ccccatccgtatccgctgatggtgcgcgatttccagaccgtcatcgggaaggaatgcctg
ctgcagatgccggaaatgacggggcggcagcccgactgcgtgatcgcctgtgtcggtggc
gggtcgaatgcgatgggcatcttccatccttacatcgacgtgcccgacgtgcgcctgatc
ggcgtcgaggcggcaggcgaggggatggaatcgggccgccatgcagccagcctcaccgcc
ggcaagcccggcgtcctgcacggcaaccggacttatctgctgcaggatgacgacggccag
atcatcgagacgcattcgatttccgccggcctcgattatccgggcgtcggacccgagcat
gcgtggctcaaggacagcggccgcgcggaatacgtgaccgtcaccgaccaggaggcgctg
aaagcgtttcatgacctgtgccgcctggagggcatcattcccgcgctcgagtcgtcgcac
gcgctcgcctacgcggcaaggctcgcgccgacgttgccgaaggacaagatcctgctggtc
aatctctccgggcgcggggacaaggacatgcacaccgtcgccgagaaatccggcatccag
ttctga

DBGET integrated database retrieval system