KEGG   Aromatoleum aromaticum: ebA4776Help
Entry
ebA4776           CDS       T00222                                 

Gene name
trpA
Definition
(GenBank) probable tryptophan synthase (Alpha chain) protein
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ebA4776 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ebA4776 (trpA)
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ebA4776 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2826363..2827178
Genome map
AA seq 271 aa AA seqDB search
MSKIQSTFQRLQVTGRRALIPFITAGDPAPELTVPLMNALVEGGADIIELGVPFSDPMAD
GPTIQRASERALANGMTLRRVLDTVREFRTGNAETPVVLMGYANPIEAMGVERFVSAARE
AQVDGVLIVDYPPEECESFARAAKDAGLDPIFLLAPTSTEQRFRDVARVGSGYIYYVSLK
GVTGSATLDFDEVAARIPQIRAQVGMPVGVGFGIRDAESARRIGEVADAVVIGSRIIEEI
ERSPRDRLAANVTAFLREVRTALDQVEGSVR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatccaatccacttttcagcgcctgcaagtcaccgggcggcgggcgctgatt
cccttcatcactgccggcgatccggcaccggagctgacggtgccgttgatgaacgcgctg
gtcgagggaggcgccgacatcatcgaactgggcgttccgttctccgacccgatggccgat
ggtccgacgatacagcgcgcctcggaacgcgctctggccaacggcatgaccctgcgcagg
gtgctcgataccgttcgcgagttccgcaccggcaacgccgagaccccggtggtcctgatg
gggtacgcgaatccgatcgaggcgatgggcgtcgagcggttcgtgtcggccgcgcgcgag
gcgcaagtcgacggcgtgctgatcgtcgactacccgccggaggagtgcgagagcttcgcg
cgggcggcaaaagacgccggactggatccgatcttcctcctcgcgccgacctcgaccgag
cagcgtttccgcgacgtcgcgagagtcggcagcggctacatctactacgtctcgctgaaa
ggcgtcaccggctccgcgacgctcgatttcgacgaggtggcggcgcgcattccgcagatt
cgcgcgcaggtcggcatgccggtcggcgttggcttcggcatccgcgatgccgagtcggcg
cggcgcatcggcgaagtggccgacgcggtggtgatcggtagccgcatcatcgaggagatc
gagcgcagcccgcgggatcggctcgccgccaatgtcactgccttcctcagggaagtccgc
acggcgctcgaccaagtcgaagggagcgtgcgatga

DBGET integrated database retrieval system