KEGG   Aromatoleum aromaticum: ebA4831Help
Entry
ebA4831           CDS       T00222                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA4831 (tpiA)
   01230 Biosynthesis of amino acids
    ebA4831 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA4831 (tpiA)
   00051 Fructose and mannose metabolism
    ebA4831 (tpiA)
   00562 Inositol phosphate metabolism
    ebA4831 (tpiA)
Enzymes [BR:eba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ebA4831 (tpiA)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ebA4831 (tpiA)
  Exosomal proteins of bladder cancer cells
   ebA4831 (tpiA)
  Exosomal proteins of melanoma cells
   ebA4831 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2865076..2865891
Genome map
AA seq 271 aa AA seqDB search
MARFDGFECMERKLVVGNWKMNGDLVSNQALFEQLVDRSPSSIDTALCVPFPYLAQGQRA
LSGSAIMLGAQNLSEFDAGAYTGEVSGRMLSDFDCRFVIVGHSERRTVFREDDQLVARKA
RAALAAGLVPIVCVGESLAERDAGQAEDVLLRQLEALVQLLDGASLARLVIAYEPVWAIG
TGRAASPEQVQEILSFVRRWLSGHVGNSRAIRILYGGSVKADSAAALFSLPDSDGGLIGG
ASLVAQQFLEICEAAAKAAQDGNMGDFKGSR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatttgacggattcgagtgcatggaacgcaagcttgtcgtcggcaactggaag
atgaacggcgatctggtaagcaatcaggcgctcttcgaacagcttgtcgaccgtagtccc
tccagcatcgatactgccctgtgtgttccgtttccttatctggcgcagggtcagcgagcg
ttgtcggggagtgcgataatgctcggcgcccagaatctgagtgaattcgatgccggagcg
tatacgggcgaagtcagcgggcggatgctttcggacttcgattgccgcttcgtcatcgtc
ggccattcggagcggcgtacggtgttccgggaggatgaccagctggttgcgcgaaaggca
cgtgccgcgctggcggcaggtctcgtgcctatcgtatgcgtcggcgagtcgcttgccgag
cgggacgcaggccaggcagaagacgtcctgttgcgccagctcgaagcattggtccagctg
ctcgacggcgcgtcgctggcacggcttgtgatcgcgtacgagccggtgtgggcgatcggg
accggacgggcggcttccccggagcaggtccaggagatcctttcgttcgtacgacgctgg
ttgtccggtcacgtgggaaattctcgcgcgatccggatcctgtatgggggaagcgtgaag
gcagacagtgccgctgcattgttcagtctgcctgattcggacggcgggctgattggcggc
gcgtcgcttgttgcccagcaatttcttgagatctgtgaagctgctgccaaggctgcacag
gacggcaatatgggtgatttcaaaggttctcgatga

DBGET integrated database retrieval system