KEGG   Aromatoleum aromaticum: ebA4955Help
Entry
ebA4955           CDS       T00222                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ebA4955 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ebA4955 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ebA4955 (thrC)
Enzymes [BR:eba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ebA4955 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2943182..2944621
Genome map
AA seq 479 aa AA seqDB search
MKYLSTRGHAARPEFCDILLGGLAPDGGLYLPESYPQISRAELDAWRSLSYADLAFAILS
KFITDIPAADLKTICDRTYTAEVYRFARPGDDAAEITPVHWLEAGKFGLLELSNGPTLAF
KDMAMQLLGNLFEYVLERRGETINILGATSGDTGSAAEYAMRGKHAVRVFMLSPHGKMSA
FQRAQMYSLQDENIHNIAVTGMFDDAQDIVKAVSNDAAFKAKYKIGAVNSINWARVAAQI
VYYFKGYFAATKSNDEQVAFCVPSGNFGNICAGHIARQMGLPVARLILATNENDVLDEFF
RTGVYRPRKAAETHVTSSPSMDISKASNFERFVFDLVGRNPERVAELWKAVDAGGAFDLS
ASADFARIGDFAFVSGGSSHAGRVATIRKVFEQYGTMIDTHTADGVKVAWDCAGSVPAGV
PLLVLETALPAKFAETIREALGREPERPAELEGIEKLPQRVELMAPDVEAVKRFIAERV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtatctctccactcgcggccacgccgcgcgacccgagttctgcgacattctgctg
ggcggtcttgcgccggatggcgggctgtatctccccgaaagttatccgcagatctcgcgc
gccgaactcgacgcttggcgctcgctgtcgtatgcggatctcgcgttcgcgatcctgtcg
aagttcatcaccgacattcccgcagccgacctgaagacgatctgcgaccggacctacact
gccgaggtttatcgctttgcgcgtccgggcgacgatgccgccgagatcacgccggtgcat
tggctcgaagccggcaagttcggtctgctggaattgtcgaacggcccgacgctggcgttc
aaggacatggcgatgcagctgctcggcaacctgttcgagtacgtcctcgagcgccgtggc
gagaccatcaacatcctcggtgcgacgtcgggcgataccggctcggcggccgaatacgca
atgcgcggcaagcacgccgtgcgcgtcttcatgctgtcgccgcacggcaagatgagcgcg
ttccagcgcgcgcagatgtattccctgcaggacgagaacatccacaacatcgccgtcacc
ggcatgttcgacgacgcgcaggacatcgtgaaagcggtgtcgaacgacgccgcgttcaag
gcgaaatataagatcggtgcggtcaattcgatcaactgggcgcgcgtggcggcgcagatc
gtctattacttcaaaggctatttcgccgcgacgaagtcgaacgacgaacaggtcgccttc
tgcgtgccgtcaggcaatttcggcaacatctgcgccggccatatcgcccgccagatgggg
ctgccggtcgcgcggctgatcctcgcgacgaacgaaaacgacgtgctcgacgagttcttc
cgcaccggcgtctatcgtccgcgcaaggctgccgaaacccacgtcacgtcgagcccgtcg
atggacatttccaaggcgtcgaatttcgagcgcttcgtgttcgatctcgtcgggcgcaac
cccgagcgcgtcgctgaactctggaaggcggtcgatgcgggcggcgccttcgacctgtcg
gcgtctgccgatttcgcccgcatcggcgatttcgcgttcgtgtccggcggcagctcgcat
gcggggcgcgtcgcgacgatccgcaaggtgttcgagcaatacggcacgatgatcgacacg
cacaccgccgacggcgtcaaggtcgcgtgggactgcgccggcagcgtcccggcgggcgtg
ccgctgctggtgctcgaaaccgcattgccggcgaagttcgccgaaacgatccgcgaagcg
ctcgggcgcgagccggagcgtccggccgagctcgaaggcatcgagaaactgccgcagcgt
gtcgaactcatggctccggacgtcgaggcagtcaagcgcttcattgccgaacgcgtgtag

DBGET integrated database retrieval system