KEGG   Aromatoleum aromaticum: ebA5005Help
Entry
ebA5005           CDS       T00222                                 

Definition
aldehyde:ferredoxin oxidoreductase,tungsten-containing (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
eba  Aromatoleum aromaticum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA5005
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ebA5005
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ebA5005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2976559..2978409
Genome map
AA seq 616 aa AA seqDB search
MGWNRKVLRVNLAEGTCTPEPLNMQWADEYLGSRGLATKYLVSETDPKVDPLSPDNKMIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMVIFEGRSPTPVY
LFIENERAELRDASYLWGRSCWETEESIRAQHQDPLIRVSSIGRAGENQVMFACIVNDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVSGIRDFPGFVRATSEAKKVLAGNPVTSEGLPK
FGTQVLMNVINEMGALPTRNHRDVQFEDASKISAEAMHEKRPSDGKPQLVTNAACFGCTI
ACGRISAIDKTHFTVKNNPKYWGASGGLEYEAAWALGAANGVGDLEALQYANLLCNEQGM
DPISFGATVGAAMELYETGVLTKERIGLDAPFGSADALAKLAEMTATGEGFGKEIGLGSK
RLCEKYGHPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGVPVK
TDPHVIEGKAELVKAFQDATAVFDSAGICVFTSFAWTLADVQPQIAAACDGDWSMDKLAT
VGERIWNMERQFNNAAGLGAQDDNLPPRLTSEPAKSGPAKGMVNRLAEMLPEYYGVRGWT
PEGTPTPETLSRLGLS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaaggtcctgcgggtgaacctcgccgaaggcacgtgcacgcctgag
ccgctgaacatgcagtgggccgacgaatacctcgggtcgcgcggtctggcaacgaaatac
ctcgtctccgaaaccgatccgaaagtcgatccgttgtcgcccgacaacaagatgatcatg
gcgaccggccccttgaccggcacgatggcctcgaccggcgggcgctacacggtagtcacg
aaaggaccgctgaccggcgcgatcgcctgttcgaactcgggcggtttcttcggcgccgag
atgaagttcgccggctgggacatggtgatcttcgaaggccgctcgccgacgccggtgtac
ctcttcatcgagaacgagcgcgccgaactgcgcgatgcatcgtacctgtggggcaggagc
tgctgggagaccgaggagagcatccgcgcgcagcaccaggacccgctgatccgcgtatcg
tcgatcggtcgcgcgggcgagaaccaggtgatgttcgcgtgcatcgtcaatgacctccac
cgcgcggcggggcgttcgggcgtcggggcggtgatgggttcgaagaacctcaaggcggtc
gcgatccgtggcacgaaaggtgtttcgggcatccgcgactttcccgggttcgtcagggcg
acgagcgaggcgaagaaagtgctcgccggcaacccggtgacgagcgagggcctgccgaaa
ttcggcacccaggtgctgatgaacgtcatcaacgagatgggcgcgctgccgacgcgcaac
catcgcgacgtgcagttcgaggacgcgtcgaagatctcggccgaggcgatgcacgaaaag
cgcccgagcgacggcaagccgcagctcgtgacgaacgccgcatgcttcggctgcacgatc
gcgtgcggccgcatctcggcaatcgacaagacgcacttcacggtaaagaacaacccgaaa
tactggggtgcatccggcgggctcgaatacgaggcggcgtgggcgctcggtgcggcgaac
ggggtcggtgacctcgaagcgctgcagtacgcgaacctgctgtgcaacgagcagggcatg
gacccgatctcgttcggcgcgacggtcggcgcggcgatggagctgtacgagacgggcgtg
ctgacgaaggagagaatcggcctcgacgcgccgttcggctcggccgatgcgctcgcgaag
ctcgccgagatgaccgcgaccggcgaaggtttcggcaaggagatcggcctcggctcgaag
cgcctgtgcgagaaatacggtcaccccgagctgtcgatgagcgtcaagggccaggaattc
cccgcctacgactcgcgcggcatccagggcatgggcctcgcgtacgcgacgtcgaaccgc
ggcgcgtgccacctgcgcggctacacggtcgcctccgaagtgctcggcgtgccggtcaag
accgacccgcacgtcatcgagggcaaggccgagctcgtcaaggcgttccaggacgcgacg
gcagtgttcgattcggccggcatctgcgtgttcacatcgttcgcgtggacgctcgccgac
gtgcagccgcagatcgccgcggcctgcgacggcgactggtcgatggacaagctcgctacg
gtcggagagcgcatctggaacatggagcgtcagttcaacaacgctgccggcttgggcgcg
caggacgacaatctgccgccgcgcctcacgagcgaaccggcgaagagcgggcctgcgaaa
ggcatggtgaatcgcctcgccgagatgctgcccgagtactacggcgtgcgcggctggacc
ccggaaggcacgccgacgccggaaacactgtcccggctggggctgtcctga

DBGET integrated database retrieval system