KEGG   Aromatoleum aromaticum: ebA5088Help
Entry
ebA5088           CDS       T00222                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eba  Aromatoleum aromaticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ebA5088 (pfkA)
   01230 Biosynthesis of amino acids
    ebA5088 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA5088 (pfkA)
   00030 Pentose phosphate pathway
    ebA5088 (pfkA)
   00051 Fructose and mannose metabolism
    ebA5088 (pfkA)
   00052 Galactose metabolism
    ebA5088 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ebA5088 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ebA5088 (pfkA)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ebA5088 (pfkA)
Protein phosphatases and associated proteins [BR:eba01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ebA5088 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3015675..3016931
Genome map
AA seq 418 aa AA seqDB search
MNKANLLYAQSGGVTAVINATAASVIEAARARADAVGRVLAARHGILGALDEDLIDTAPL
SVVDLRRLAGTPGGAFGSCRFDLDPPEANRDQYDRLFAVLAAHDIGYFLYNGGNGSMDTV
AKVSRAAAERGYPLVCVGVPKTVDNDLEGTDCSPGFGSAAKYAATSMLEAGLDLAAMTSR
VGRAFVLEVMGRNAGWLAAATALAARNDDEPPHVILMPEVPFDEEAFLAVVRSTVSRLGY
CAVTVSEGIRRADGSLLMEQDEDAKGHVQLGGAGQCIARLIHSRLGYKHHWAIPDYLQRA
AGHLVSATDHAQARAVGQAAVEYALAGRDGVMAAIRRLADAPYRWDVAPVAVAAIANLER
QVPRAFIRPDGLHVTDAARTYLRPLIEGEMPACFAGGLPDYPRFPLPGVPRKLAPYRP
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagccaacctgctctatgcccagtccggcggggtgaccgcggtcatcaacgcg
accgcggcaagcgtcatcgaagcggctcgggcccgcgccgatgcggtcggccgggtgctt
gcggcgcggcatggcattctcggcgcgctcgacgaggacctgatcgacaccgcgccgctg
tcggtcgtcgatctgcgccgcctggccggcacgccgggcggggcgttcggctcgtgccgc
ttcgacctcgatccgccggaggcgaatcgcgaccagtacgaccgcctgttcgcagtgctt
gcggcccacgacatcggttatttcctctacaacggcggcaacggctcaatggatacggtc
gcgaaagtgtcgcgcgcggccgcggagcgcggctatccgctggtctgcgtcggagtgccg
aagaccgtcgacaacgacctcgaaggcactgactgttcacccggtttcggctccgcggcg
aagtacgcggcgacgtcgatgctcgaagccgggctcgacctggcggcgatgacgagccgc
gtcgggcgcgcgttcgtgctggaagtcatggggcgcaacgccggctggctggccgcagcg
accgcgctcgccgcgcgcaacgacgacgagccgccgcatgtgatcctgatgcccgaagtg
ccgttcgacgaggaagcttttctcgcggtggtccggtccaccgtgtcgcgtctcggctat
tgcgcggtcaccgtctcggaaggcatccgtcgcgccgacggctcgctgctgatggagcag
gacgaggatgcgaaaggccatgtccagctcggcggggccgggcagtgcatcgcgcgcctg
atccactcgcgcctcggctacaagcatcactgggcgattccggactacctgcagcgcgcg
gccggccacctggtgtcggcgaccgaccacgcgcaggctcgtgcggtcgggcaggcggcg
gtggagtatgcgctggcggggcgcgacggcgtgatggccgcgatccgccgcctcgccgac
gccccataccgctgggacgtcgcgcccgtcgcggtggccgcgatcgcgaacctcgaacgc
caggtgcctcgcgccttcattcgccccgacgggctgcacgtcaccgacgccgcgcgcacg
tacctgcgcccgctgatcgaaggggaaatgccggcgtgttttgccggcgggctgccggat
tatccgcgtttcccgctgcccggtgtgccgcgcaagctcgcgccgtaccgtccgtga

DBGET integrated database retrieval system