KEGG   Aromatoleum aromaticum: ebA5199Help
Entry
ebA5199           CDS       T00222                                 

Gene name
cbiB
Definition
CobD/CbiB family protein
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
eba  Aromatoleum aromaticum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ebA5199 (cbiB)
Enzymes [BR:eba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     ebA5199 (cbiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3081426..3082352
Genome map
AA seq 308 aa AA seqDB search
MTLFSLIVALLIEQLRPLPVRQVVLDPLRRFSGVLVDRFNDGRARNGTLAWWLLMLLAVL
GGALVFVLLWLIHPALAFAFNIAVLYLTMGFRQESHYFTDIHLALRMDELARARTLLGEW
RGGQYSEASSSEVARLAIEKALVAAHRNVFGVVFWFIVMPGPTGAILYRLARFLGEEWGQ
RRDAEFGEFGRFARKAFAVIDWVPARLTAASFSVVGDFEDALFCWRTQAMLWGERASGIL
IAAGAGALGVRLGMPVHESGEIVERPEMGVGAEADAEYMQSTVGLVWRALVLCLLMLALV
VIAGWVGR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttctcgctgatcgttgcgctgctcatcgagcagctgcgcccgctgccggtc
cggcaggtggttctggatccccttagacggttttccggcgtacttgttgaccgcttcaac
gacggccgggcgcggaacggaacgctcgcgtggtggttgctgatgcttctcgcggttttg
ggaggcgcgttggtcttcgtcctgctgtggctgatccacccggcgctcgcgttcgcgttc
aatatcgccgtactgtatctgacgatgggctttcgtcaggagagccattacttcaccgac
atccacctcgcgctgcgcatggacgaacttgcccgcgcccgcacgctcctcggcgaatgg
cgcggcggacagtattccgaggcgagttcgagcgaggtggcgcggctcgcgatcgagaaa
gcgctcgtcgcggcgcaccgcaacgtgttcggtgtggtgttctggttcatcgtcatgccc
gggccgacaggcgcgattttgtatcgcctggcgcgcttcctcggtgaagaatgggggcag
cgccgtgatgccgaattcggcgagttcggccgcttcgcgagaaaagcattcgcggtcatt
gactgggtgccggcccgcctgaccgcagcgtcgttttcggtcgtcggcgacttcgaggac
gcgctgttctgctggcgtacccaggcgatgctttggggcgaaagggcgtccggtatactg
attgccgcgggtgcgggagcgctgggagtgcgtctgggaatgcccgtgcacgaatccggc
gagatcgtcgagcggccggaaatgggcgtcggcgcggaagccgatgccgaatacatgcag
agtaccgtgggcctggtatggcgagcgctggtgctttgcctgttaatgctcgctttggtt
gtgatagccggttgggttggtcgttga

DBGET integrated database retrieval system