KEGG   Aromatoleum aromaticum EbN1: ebA5199Help
Entry
ebA5199           CDS       T00222                                 

Gene name
cbiB
Definition
CobD/CbiB family protein
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eba00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3081426..3082352
Genome map
AA seq 308 aa AA seqDB search
MTLFSLIVALLIEQLRPLPVRQVVLDPLRRFSGVLVDRFNDGRARNGTLAWWLLMLLAVL
GGALVFVLLWLIHPALAFAFNIAVLYLTMGFRQESHYFTDIHLALRMDELARARTLLGEW
RGGQYSEASSSEVARLAIEKALVAAHRNVFGVVFWFIVMPGPTGAILYRLARFLGEEWGQ
RRDAEFGEFGRFARKAFAVIDWVPARLTAASFSVVGDFEDALFCWRTQAMLWGERASGIL
IAAGAGALGVRLGMPVHESGEIVERPEMGVGAEADAEYMQSTVGLVWRALVLCLLMLALV
VIAGWVGR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttctcgctgatcgttgcgctgctcatcgagcagctgcgcccgctgccggtc
cggcaggtggttctggatccccttagacggttttccggcgtacttgttgaccgcttcaac
gacggccgggcgcggaacggaacgctcgcgtggtggttgctgatgcttctcgcggttttg
ggaggcgcgttggtcttcgtcctgctgtggctgatccacccggcgctcgcgttcgcgttc
aatatcgccgtactgtatctgacgatgggctttcgtcaggagagccattacttcaccgac
atccacctcgcgctgcgcatggacgaacttgcccgcgcccgcacgctcctcggcgaatgg
cgcggcggacagtattccgaggcgagttcgagcgaggtggcgcggctcgcgatcgagaaa
gcgctcgtcgcggcgcaccgcaacgtgttcggtgtggtgttctggttcatcgtcatgccc
gggccgacaggcgcgattttgtatcgcctggcgcgcttcctcggtgaagaatgggggcag
cgccgtgatgccgaattcggcgagttcggccgcttcgcgagaaaagcattcgcggtcatt
gactgggtgccggcccgcctgaccgcagcgtcgttttcggtcgtcggcgacttcgaggac
gcgctgttctgctggcgtacccaggcgatgctttggggcgaaagggcgtccggtatactg
attgccgcgggtgcgggagcgctgggagtgcgtctgggaatgcccgtgcacgaatccggc
gagatcgtcgagcggccggaaatgggcgtcggcgcggaagccgatgccgaatacatgcag
agtaccgtgggcctggtatggcgagcgctggtgctttgcctgttaatgctcgctttggtt
gtgatagccggttgggttggtcgttga

DBGET integrated database retrieval system