KEGG   Aromatoleum aromaticum: ebA5202Help
Entry
ebA5202           CDS       T00222                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00071  Fatty acid degradation
eba00072  Synthesis and degradation of ketone bodies
eba00280  Valine, leucine and isoleucine degradation
eba00310  Lysine degradation
eba00362  Benzoate degradation
eba00380  Tryptophan metabolism
eba00620  Pyruvate metabolism
eba00630  Glyoxylate and dicarboxylate metabolism
eba00640  Propanoate metabolism
eba00650  Butanoate metabolism
eba00900  Terpenoid backbone biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
eba01212  Fatty acid metabolism
eba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ebA5202
   00630 Glyoxylate and dicarboxylate metabolism
    ebA5202
   00640 Propanoate metabolism
    ebA5202
   00650 Butanoate metabolism
    ebA5202
  Lipid metabolism
   00071 Fatty acid degradation
    ebA5202
   00072 Synthesis and degradation of ketone bodies
    ebA5202
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ebA5202
   00310 Lysine degradation
    ebA5202
   00380 Tryptophan metabolism
    ebA5202
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ebA5202
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ebA5202
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ebA5202
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ebA5202
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ebA5202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAI09076
UniProt: Q5P0T8
Position
3082375..3083556
Genome map
AA seq 393 aa AA seqDB search
MANREVVVLSAVRSAVGGFGGSLKDMEPAELGAVVVKEAIARSGVDAKQISFAAVGNCIP
TESRYPYVARLATVQGGMSMDSVAFAVNRLCGSAQQAIVNSAQAIMLGDADFAIGGGVEV
MSRGAYLLPALRSGARMGDTKAIDAMVAVLTDPFGVGHMGVTAENLTTKWNISREEQDAF
ALESQNRAAAAIADGRFKSQIVPITFETRKGPVVFDTDEHPRMTTMEALGKMKPAFKKDG
SVTAGNASGINDAASFLVLAEAGKAAAAGHKPIARLVAYAIAGVPNDLMGEGPIPASKLA
LQRAGLTLDKIDVIESNEAFAAQSIAVNRGLDLDPKKTNPNGGAIALGHPVGATGGVIIT
KLLHELIRVNGRYGMATMCIGGGQGITTIWERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcgtgaagtagtggttttgagtgcggtacgttcggcggtcggcggtttcggc
ggttcgctgaaggacatggaaccggctgaactcggcgctgtggtcgtcaaggaagcgatt
gcccgctccggcgtggacgcgaagcagatcagcttcgccgcggtcggcaactgcatcccg
accgagtcgcgctacccttacgtcgcgcgcctggcgacggtgcagggcggcatgtcgatg
gattcggtcgccttcgcggtcaaccgcctgtgcggatcggcgcagcaggcaatcgtcaat
tcggcgcaggccatcatgctcggcgacgcggatttcgcgatcggcggcggcgtcgaagtg
atgtcgcgcggcgcgtacctgctgccggcgctgcgcagcggcgctcgcatgggagacacc
aaggcgatcgacgcgatggttgcagtcctgaccgatccgttcggggtcggacacatgggt
gtgaccgcagaaaacctgacgacgaagtggaacatcagccgcgaggagcaggacgcattc
gcgctggagtcgcagaaccgtgcggcggcggcgatcgccgatggccgtttcaagagccag
atcgtgcccatcacgttcgagacgcgcaaaggaccggtcgtcttcgacaccgacgagcat
ccgcgcatgacgacgatggaagcgctggggaagatgaagccggccttcaagaaggacggt
tcggtgactgctggcaacgcttcgggcatcaacgacgcggcgagcttcctggtcctggcc
gaggcgggcaaggctgcggccgcagggcacaagccgatcgcacgcctggtcgcttacgcg
atcgccggcgtgccgaacgacctgatgggcgaaggcccgatccccgcttcgaagctcgcg
ctgcagcgcgccgggctgacgctggacaagatcgatgtcatcgaatcgaacgaagcgttt
gccgctcagtcgatcgctgtcaaccgtggcctcgacctcgacccgaagaagacgaacccg
aacggcggcgctatcgcgctcggccatccggtcggtgcgaccggcggggtgatcatcacc
aagctgctgcacgagctgatccgcgtcaatggccgctacggcatggcgacgatgtgcatc
ggcggcggccagggcatcacgacgatctgggaacgcgtctga

DBGET integrated database retrieval system