KEGG   Aromatoleum aromaticum EbN1: ebA5271Help
Entry
ebA5271           CDS       T00222                                 

Gene name
asnB
Definition
asparagine synthetase (glutamine amidotransferase) protein (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eba00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3128389..3130161
Genome map
AA seq 590 aa AA seqDB search
MCGIAGEIRFDGQSPDVGALERMNARQRVRGPDSGGVFVQGALGFGHRRLKIIDLSESAQ
QPMFDPALGLGIVFNGAIYNHAALRRELETLGYRFYSRGDTEVLLKAYHAWGQDFVQRLN
GMFAFAIWERDSGRVVLGRDRLGIKPLYYSAQPGLLRFASSLPALVAAGGVDTTVDAVAL
NHYLSFHAVVPAPHTILAGVRKLPPATLMTIHTDGRRSERSYWSLAYAHEPGDAARSFEE
WTEILLEGLRSAVGRRLVADVPVGALLSGGVDSSLIVGLMAQAGVQGLRTYNVGFEDVGG
EKGNEFEYADIVAERFATIHERIFVPEAQLLARLPEAVAAMSEPMVSHDCIGFFLLSEAV
SRHSKVVQSGQGADEVFGGYHWYPKLAGSVDPVGDYLAAFRDRDYDEYCRMVGAANRADD
CSGAFVAAHFDLPGAIDPVDKALRLDTTVMLVDDPVKRVDNMTMAFGLEARVPFLDHELV
ELAARIPARHKLAHGGKGVLKEAARQVIPSAVIDRPKGYFPVPGLKYLQGQVLERVRDAL
TNRAARERGLFRREYVDTLLADPGAHMTPLRGSKLWQLGLLEWWLQTHVR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgcaggtgaaatcagattcgatgggcagtcgcccgacgtgggggcgctg
gagcggatgaatgcgcggcagcgcgtgcgcggccccgacagcggcggcgtgttcgtgcaa
ggcgcgctcggcttcggccaccgccggctgaagatcatcgacctgtccgaatcggcgcag
cagccgatgttcgacccggccctcggcctcgggatcgtcttcaatggggcgatctataac
cacgccgcgctgcgccgcgagctcgagactctcggctaccgcttctactcgcgcggggat
acggaagtcctgctgaaggcctaccacgcgtgggggcaggatttcgtgcagcggctcaac
ggcatgttcgcgttcgcgatctgggagcgggacagcggccgcgtcgtgctcggtcgcgac
cggctcggcatcaagccgctgtattacagcgcacagcccggcctgctgcgcttcgcgtcg
agcctgccggcgctcgttgccgccggcggcgtcgacaccacggtcgatgcggtggcgttg
aaccactacctctcgttccatgcggtcgtgccggctccgcacacgattcttgccggtgtg
cgcaagctgccgcccgcgacgctgatgacgatccacacggacgggcgtcgcagtgaacgc
agctactggtcgctggcctacgctcacgagccgggcgacgcggcgcgcagcttcgaggag
tggacggaaatcctgctcgaaggcttgcgcagtgcggtcggccgccgcctggtcgccgac
gtgccggtcggcgcgctgctgtccggcggcgtcgattcgagtctgatcgtcgggctgatg
gcgcaggccggcgtgcagggcctgcggacctacaacgtcggcttcgaggacgtcggcggg
gaaaagggcaacgagttcgaatatgccgacatcgtcgccgaacgtttcgccacgatccac
gaacgcatcttcgtgcccgaggcgcaactcctcgcgcggctgccggaagcggtcgcggcg
atgagcgagccgatggtgagtcatgactgcatcggcttcttcctgctgtcggaggcagtg
tcgcgccattcgaaagtcgtgcagagcgggcagggggcggacgaagtgttcggcggctac
cactggtacccgaagctcgccggcagcgtcgacccggtcggcgattacctcgcggcattt
cgcgaccgcgactacgacgagtattgccgcatggtcggcgcggcgaatcgtgccgacgat
tgcagcggtgcgttcgtcgccgcccacttcgacctgcccggtgcgatcgacccggtcgac
aaggcactgcgtctcgataccaccgtgatgctcgtcgatgatccggtaaaacgcgtcgat
aacatgacgatggcgttcggtctggaggcccgcgtgcctttcctcgaccatgaactcgtc
gagctggcggcgcgcattcctgcgcgacacaagctcgcccacggcggcaagggcgtactg
aaggaggcggcgcgccaggtcattccttccgcggtcatcgaccggccgaaaggctatttt
ccggtgccggggctgaaatacctgcaaggccaagtgctcgagcgggtgcgcgacgcgttg
acgaaccgcgcggcccgggagcgcggcctgttccgccgggagtatgtcgacacgctgctc
gccgatcccggcgcgcacatgacaccgctgcgcggctccaaactctggcagctcgggctg
ctcgaatggtggctgcagacccatgtccgctga

DBGET integrated database retrieval system