KEGG   Aromatoleum aromaticum: ebA5399Help
Entry
ebA5399           CDS       T00222                                 

Gene name
padG
Definition
phenylglyoxylate:acceptor oxidoreductase
Orthology
K18355  
phenylglyoxylate dehydrogenase alpha subunit [EC:1.2.1.58]
Organism
eba  Aromatoleum aromaticum
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ebA5399 (padG)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.58  phenylglyoxylate dehydrogenase (acylating)
     ebA5399 (padG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3207879..3209138
Genome map
AA seq 419 aa AA seqDB search
MSTTTLEKPAVSAPKKQKVMLCEGNEAAALAVALARPDMVAVYPITPQSSLVEHVASLIA
DGKMDADIVDAEGEHSVLSVLQGGALAGARTYTATCGPGLAFMFEPYFRTSGMRLPIVMS
IVTRDGITPQCVWGGHQDAMTVREVGWVQIYCETVQEVLDTTVMAFRIAEDHDVMLPVNI
CLDGNYLSYGTARIELPEQSDVDAFMGAKDVNWHVALDPLKPMAVDPLTGGAGGKGPATF
VRYRKSQCRGMQNALGVIEAVHAEWAERFGRSYAPLVEEYRLEDAEFAIMTLGSMTGAAK
DAVDEAREAGKKVGLIKIKTFSPFPVEALTRALSKVRALGVVDRSVGFRWNCGPMYQEVL
GVLYRLAGQTGTVLPAMSFIGGLAGADITTGHFHRVIDATERLLDGPAPTEPVWLNEND
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccacgctcgaaaaacccgccgtcagcgcaccgaagaagcagaaagtgatg
ctgtgcgaaggcaacgaagcggccgcgctggccgtcgcgctcgcgcgccccgacatggtc
gcggtgtatccgatcacgccgcagtcctcgctcgtcgagcacgtcgccagcctcatcgcc
gacggcaagatggacgccgacatcgtggacgccgaaggcgaacactcggtgctgtcggtg
ctgcaaggcggcgccctggccggcgcgcgcacctacacggcgacctgcgggcctggcctc
gcgttcatgttcgagccgtatttccgcacttccggcatgcgcctgccgatcgtgatgtcg
atcgtcacgcgcgacggcatcacgccgcagtgcgtgtggggcgggcaccaggacgcgatg
acggtgcgcgaagtcggctgggtgcagatctactgcgaaacggtgcaggaagtgctcgac
acgacggtgatggcgttcaggatcgccgaagaccacgacgtgatgctgccggtgaacatc
tgtctcgacggcaactacctgtcgtacggcacggcgcgcatcgagctgcccgagcagtcg
gacgtcgatgcgttcatgggggcgaaggacgtcaactggcacgtcgccctcgacccgttg
aagccgatggcggtcgatccgctcaccggtggcgcgggcggcaaggggccggcgacattc
gtgcgctatcgcaagagccagtgccgcggcatgcagaacgcgctgggcgtgatcgaagcg
gtgcatgccgagtgggccgagcgcttcgggcgcagttacgccccgctcgtcgaggagtac
cgcttggaggatgccgagttcgcgatcatgacgctcggcagcatgacgggggcagcgaag
gacgcggtcgacgaggcgcgcgaagccggcaagaaagtcggcctcatcaagatcaagacg
ttcagcccgttcccggtcgaagccttgacgcgcgccttgtcgaaagtgcgcgcgctcggc
gtcgtcgaccgttcagtcggtttccgctggaactgcgggccgatgtaccaggaagtgctc
ggtgtgctgtaccgcctcgcggggcaaacgggcacggtgctgccggcgatgagcttcatc
ggcgggctggctggcgcggacatcacgaccgggcacttccaccgcgtcatcgacgccacc
gagcggctgctcgacgggccagcgcctaccgagccggtgtggctcaacgagaatgactga

DBGET integrated database retrieval system