KEGG   Aromatoleum aromaticum EbN1: ebA5994Help
Entry
ebA5994           CDS       T00222                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eba00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3555312..3556523
Genome map
AA seq 403 aa AA seqDB search
MSDPTPPRLQRVTVLGATGSIGMSTLDVLARHPDRFEAFALTAQIQVERLFELCLRFSPR
FAVLVDSAAASDLRQRLKAAGSATEVLAGPGALVDVAAHPDSDAVMAAIVGAAGLAPALA
AARAGKRVLLANKEALVLSGRLFMQAVVESGAELLPIDSEHNAVFQALPQGYARDPQRCG
VRRVLLTASGGPFRERSIESLADVTPDEACAHPNWVMGRKISVDSATMMNKGLEVIEAHW
LFAVPPEAIEVVVHPQSVIHSMVEYADGSVLAQLGNPDMRTPIAHALAYPERIDAGVRPL
DLFEIGRLNFERPDFVRFPCLALAYDALREGGAAAAVLNAANEEAVAAFLERRVGFTRIP
DIIAATLERARDLSVDCIEAILDADARAREVARSEILARQTTP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccgactcccccacgtctgcaacgcgtcacagtgctcggcgcgaccggttcc
atcggcatgagtacgctcgatgtactcgcccggcatccggaccgcttcgaggcgttcgcg
ctcaccgcgcagatccaggtcgagcgcctgttcgagctgtgcctgcgcttttcgccgcgc
ttcgcggtgctcgtcgattcggccgcggcgtccgatctccgccagcgcctgaaagccgcc
ggttcggcgacggaagtgctcgccggccccggagcgctcgtcgatgtcgcggcgcatccc
gacagcgacgcggtgatggcggcgatcgtcggcgccgcgggccttgcgccggcgctcgcc
gcggcgcgcgccggcaagcgcgtgctgctcgcgaacaaggaggcgctggtgctgtccggg
cggctcttcatgcaggcggtggtcgagagcggcgccgagctgctgccgatcgacagcgag
cacaacgccgtcttccaggcgctgccgcagggttacgcgcgcgatccacagcgctgcggc
gtgcggcgcgtcctgctgacggcatccggcggtccgtttcgcgagcgctcgatcgagagc
ctcgcggacgtcacgccggacgaagcgtgcgcccatccgaactgggtcatggggcgaaag
atctcggtcgactcggcgacgatgatgaacaaggggctcgaagtcatcgaggcccactgg
ctgttcgcggtgccgccggaggcgatcgaagttgtcgtgcatccgcagagcgtcatccat
tcgatggtcgaatatgccgacggctcggtgctcgcgcagctcggcaacccggacatgcgc
acgccgatcgcgcacgcgctcgcctatcccgaacgcatcgacgccggcgtgcgcccgctc
gatctgttcgagatcggccggctgaacttcgagcgcccggacttcgtccggtttccgtgc
ctggcgctcgcgtacgacgcgttgcgcgaaggcggggcggcggcggccgtgctcaacgcc
gcgaacgaggaagccgtcgccgcgttcctcgagcggcgcgtgggattcacgcgcatcccc
gacatcatcgcggcgacgctcgaacgcgcgcgcgatctgtcggtcgattgcatcgaggca
atcctcgatgccgatgcgcgcgcacgtgaagtcgcgcgaagtgaaatcctcgcccgacag
acgactccatga

DBGET integrated database retrieval system