KEGG   Aromatoleum aromaticum EbN1: ebA6179Help
Entry
ebA6179           CDS       T00222                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eba00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3661907..3662557)
Genome map
AA seq 216 aa AA seqDB search
MSDIHDQHQHPQPPSAAGIGIPRSGSFDPAAFERAVNDLLRACGVAPDAIHTGKTSTRVR
ELWQRRLLGGYDMDPAEALGDGFDDDRTDMVVIRGIAVHGVCPHHLVPFRGVAHVAYLPG
GRLHGFGRIARLVDAIGHRFTYQEWMTRDIADALLRHGHARGAACIVEAEQLCLLLGEDR
RGDERVVTQAFAGEFETREHLRGEFLHAISGRTSGR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacattcacgaccagcaccagcatcctcagccgccctccgccgccgggatcggc
atcccccgtagcgggagcttcgatccggccgcgttcgaacgggccgtcaatgacctgctg
cgcgcgtgcggcgtcgccccggacgcgatacataccggaaaaacctccacccgcgtacgc
gaactctggcagcgccggctgctcggcggctacgacatggaccccgcggaggcgctcggc
gacggtttcgacgacgatcggaccgacatggtggtgatacgtggcatcgccgtgcatggc
gtgtgcccgcaccacctcgtgccattccgcggcgtggcgcacgtcgcctacctgcccggt
ggccggctgcacggcttcggacgtattgcccgcctcgtcgacgcgatcgggcatcgcttc
acttaccaggaatggatgacgcgggacatcgcggacgcgctgctgcggcacggccatgca
cgaggagcagcctgcatcgtcgaggccgagcaactgtgcctgctgctcggcgaggaccgc
cgcggcgacgaacgggtcgtgacgcaggcgttcgccggcgaattcgagacgcgcgagcac
ctgcgcggcgaattcctgcacgcgatctcgggccgcacctccggccgttga

DBGET integrated database retrieval system