KEGG   Aromatoleum aromaticum EbN1: ebA6272Help
Entry
ebA6272           CDS       T00222                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
eba  Aromatoleum aromaticum EbN1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:eba00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3712825..3714786)
Genome map
AA seq 653 aa AA seqDB search
MSQDQNQDQKLDGQPDPSRRKFLNTAAFAGLAGAGLSVGLSACKQEQAPSAAPAAPAAAA
PAEAVPVEHVGKYEVAPGQLDTYYSFSSGGHSGDVRIYGLPSGRQLKSIPVFNTDCMVGW
GITNESKAIIGTKPDGSMKYRTGDTHHVHPSYTDGTYDGKYLWVNDKIHGRLARVRLDTM
ECDKITELPNVQGFHGTFPDKRDPVDPAINHTTRVFCGTEFSIPLPNDGHGLDDVAAYRS
VFSCVDAESMEVRWQVLIDGNCDLVASSYDGKLACTNQYNVEMGVHYEETMAAEWDACLF
FNIARIEEAVKAGKVTYIGDSKVPVVDGLRASNADPKTALTCYVPIPKNPHGVNTSPDGK
YYACSGKLSPTATVISHEQVLKWFDGGVKEARECVVAEPEIGLGPLHTGFDNKGNAYTTL
FLDSQIVKWNVEAAIKSYQGDKTATPVVDRLDVHYQPGHGFTSMGETKEADGKFFISDNK
FSKDRFLPVGPLHPETAQMIDISGDKMVLVADHSVTSEPHDSIVIRRDIIKTRQVYTLED
FPHAVKDPKESGVFREGKKVTVKLTSQAPAYSLREFRVKKGDEVTIILTNHDKVEDLTHG
FAIPKHDINFAVSPQETKSVTFIADKPGVYWCYCTHFCHALHLEMRSRMIVEA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggaccagaaccaggatcaaaagcttgacggtcagccggaccccagccgtcgg
aagttcctcaataccgcagcatttgccggccttgccggcgccggactatcggtcgggctg
tcggcgtgcaaacaggagcaggcgccgtccgccgcacctgccgcgcccgctgctgcggcc
ccggccgaagccgtgcctgtcgagcatgtcggcaagtatgaagtcgcgccgggccaactc
gatacctattattcgttctcgagtggcggccactcgggcgacgtgcgcatctacggcctg
ccgtccggccgccagctgaagagcatcccggtattcaatacggactgcatggtcggctgg
gggatcacgaacgaatcgaaggcgatcatcggcaccaagcccgacggcagcatgaagtat
cggaccggtgacactcaccacgtgcacccgtcgtataccgatggcacctatgatggcaag
tacctctgggtgaacgacaagatccatggccggctcgcccgcgtgcgtctcgacacgatg
gagtgcgacaagatcaccgaactgccgaacgtccagggttttcacggcacgttccctgac
aagcgcgatccggtcgatcccgcgatcaaccacaccacgcgcgtcttctgcggcacggaa
ttctcgattcccttgccgaacgacgggcacggcctcgacgacgtcgccgcgtaccgttcg
gtgttctcctgcgtcgacgcggaatcgatggaagtacgctggcaagtgctgatcgacggc
aactgcgatctggtcgccagttcgtacgacggcaagcttgcctgcacgaaccagtacaac
gtcgaaatgggtgtccactacgaagaaacgatggctgcggagtgggatgcgtgtctgttt
ttcaacatcgcgcgcatcgaggaagcagtcaaggcggggaaagtcacttatatcggcgac
tccaaagtccccgtggtcgatggcctgagggcatcgaacgccgatccgaagactgcgctg
acctgctacgtgccgattcccaagaacccgcatggtgtcaataccagtccggacggaaaa
tactacgcctgctcgggcaagctttctccgacagcgaccgtgatttcccacgagcaggtc
ctgaagtggttcgacggtggcgtgaaggaggcgcgcgaatgcgtcgtcgccgagccggaa
atcggtcttggcccgctgcacaccggtttcgacaacaagggcaatgcgtacacgacgctg
ttcctcgacagccagatcgtcaagtggaacgtcgaagcggcgatcaagtcgtatcaaggc
gacaaaactgccactcccgttgtcgaccggctcgacgtgcactaccagccgggtcacggc
ttcacgtcgatgggcgaaaccaaagaggcggacggcaagtttttcatctcggacaacaag
ttctcgaaagaccgcttcctgccggtcggcccgctgcatccggaaacggcgcagatgatc
gacatcagcggagacaagatggtgctggtcgccgaccactcagtgacctccgagccgcat
gattcgatcgtcatcaggcgcgacatcatcaagacgcgtcaggtgtacaccctcgaggat
ttcccgcatgcggtgaaggatccgaaggaatcgggcgtgttccgcgaaggcaagaaagtc
acggtcaagctgacgagccaggcgcccgcttacagcctgcgcgaattcagggtcaagaag
ggtgacgaagtgacgatcatcctgaccaaccacgacaaggtcgaggacttgacccatggc
ttcgccatcccgaagcacgatatcaatttcgccgtcagcccgcaggaaacgaagtcggtc
acgttcatcgccgacaagcccggcgtgtactggtgctactgcacccacttctgccacgcg
ctgcatctggaaatgcgcagccgcatgatcgtcgaagcgtaa

DBGET integrated database retrieval system